SecReT4
Protein ID: 77164164
T4SS name [ID]Tfc [702]
Gene symbol-
Locus tagNoc_0640
StrainNitrosococcus oceani ATCC 19707
Repliconchromosome [GenBank: NC_007484] [Browse all T4SS(s) in this replicon]
Location [Strand]690133..690435 [+]
Producthypothetical protein
Component typeTfc9
UniProt IDQ3JDD7
KEGG IDnoc:Noc_0640
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 3.8e-28, Aligned region: 20..98
Protein Sequence: 100 a.a.     [Download]
>gi|77164164|ref|YP_342689.1| hypothetical protein Noc_0640 [Nitrosococcus oceani ATCC 19707]
MKRQFWPSTFLILGLCVAPAAFADADAEREALAKIIHELNALETLINRAEVNADRDSRIRFRYDWLRQDL
KQIKDGIQSHIDSPRAQPRSFPPLRGDYRR
 
Nucleotide Sequence: 303 bp     [Download]
>gi|77163561|ref|NC_007484.1|:690133-690435 Nitrosococcus oceani ATCC 19707 chromosome, complete genome
ATGAAACGCCAATTCTGGCCATCAACTTTTCTGATTCTAGGCTTGTGCGTCGCGCCGGCGGCGTTCGCTG
ATGCAGACGCGGAGCGTGAGGCGCTGGCGAAAATCATCCATGAGCTCAATGCCCTCGAGACGCTAATCAA
TCGCGCTGAGGTCAATGCTGATCGGGATTCCCGTATCCGATTTCGTTATGACTGGCTGCGTCAGGATCTG
AAGCAGATCAAGGACGGCATCCAGTCACACATCGATTCCCCCCGCGCGCAGCCTCGCTCATTTCCGCCAT
TGCGCGGCGATTACCGTCGATAG
 Primer design