SecReT4
Protein ID: 77164167
T4SS name [ID]Tfc [702]
Gene symbol-
Locus tagNoc_0643
StrainNitrosococcus oceani ATCC 19707
Repliconchromosome [GenBank: NC_007484] [Browse all T4SS(s) in this replicon]
Location [Strand]691192..691572 [+]
Producthypothetical protein
Component typeTfc11
UniProt IDQ3JDD4
KEGG IDnoc:Noc_0643
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 4.5e-40, Aligned region: 4..117
Protein Sequence: 126 a.a.     [Download]
>gi|77164167|ref|YP_342692.1| hypothetical protein Noc_0643 [Nitrosococcus oceani ATCC 19707]
MSNDHETLADRLNAEPAIFKGCSSSELGMIVGFAIVVWLPLSLLLAWLLGAITMGFGIAGVGVVATVVVM
ATLFQRIKRGRPEGYYQQWLRIRLQTMGLYRTPWVLRSGSWDIGRTHYAPLPTRNR
 
Nucleotide Sequence: 381 bp     [Download]
>gi|77163561|ref|NC_007484.1|:691192-691572 Nitrosococcus oceani ATCC 19707 chromosome, complete genome
ATGTCCAACGACCATGAAACTCTGGCGGATCGGCTCAATGCCGAGCCCGCCATCTTTAAAGGCTGCTCAT
CCTCTGAGCTCGGCATGATTGTGGGGTTTGCCATCGTGGTATGGCTGCCCCTCAGTCTCTTACTGGCCTG
GTTGCTGGGGGCAATCACTATGGGCTTTGGTATCGCCGGTGTCGGTGTGGTGGCCACCGTCGTGGTTATG
GCGACGTTGTTTCAGCGTATCAAACGCGGGCGGCCTGAGGGCTATTACCAACAATGGCTACGTATTCGTT
TGCAAACGATGGGGCTGTATCGCACGCCCTGGGTATTACGTAGCGGGTCCTGGGACATTGGGAGAACGCA
CTATGCGCCGCTACCGACTCGAAATCGATAA
 Primer design