SecReT4
Protein ID: 77164176
T4SS name [ID]Tfc [702]
Gene symbol-
Locus tagNoc_0652
StrainNitrosococcus oceani ATCC 19707
Repliconchromosome [GenBank: NC_007484] [Browse all T4SS(s) in this replicon]
Location [Strand]700045..701385 [+]
Producthypothetical protein
Component typeTfc22
UniProt IDQ3JDC5
KEGG IDnoc:Noc_0652
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 446 a.a.     [Download]
>gi|77164176|ref|YP_342701.1| hypothetical protein Noc_0652 [Nitrosococcus oceani ATCC 19707]
MIKRYVFHVLLLSSVLSVSHGVNAAQGPTEDGLWYYEIGGAEPVSVPANPSVVSVTLGGSAQLGLGYSCG
KFDPVAAVTNTLNDIGAGVDNMMNAMTAAATSAIAALPALILQRANPGLYDLFQNALIKAEETMQLATKS
CELMEAEIAQGKNPYADLITLSKGNDWKVQMGVGGNDAVTAKTTVESSNGDNGVPWIGGQAGGSGQPVLE
FTGDIVEAGYNINMNRAVTDASPVPAASSTRLSEIWPYPVDARDWTVDVVGENIVTTCDTCRKDSIPGTG
LLPKLYQESATVTTDIQNLVSGATPLTLTNLDQITAPGVAITRQVVEAIREMPASEQSLIMGRLVSEIST
ARTVEKALFARRLLLSGRQVPEVYATEVAREHADTSIAELDKEIENLLFETRVRKEVVSDTVTTLLERAA
ARRQSSLTVPEVPTLDPNPLRGGRVQ
 
Nucleotide Sequence: 1341 bp     [Download]
>gi|77163561|ref|NC_007484.1|:700045-701385 Nitrosococcus oceani ATCC 19707 chromosome, complete genome
ATGATCAAACGATACGTATTTCATGTGCTGCTGCTGTCATCGGTCTTATCCGTCAGTCACGGTGTAAACG
CTGCTCAAGGTCCTACCGAAGACGGTTTGTGGTACTACGAAATCGGTGGAGCGGAACCCGTCTCTGTGCC
CGCCAATCCGTCGGTAGTCTCCGTCACCCTGGGTGGATCCGCCCAATTGGGGCTTGGATACAGTTGCGGC
AAGTTCGATCCGGTGGCGGCGGTTACCAATACCTTGAACGACATTGGTGCCGGTGTCGACAACATGATGA
ACGCGATGACGGCAGCCGCCACCAGCGCCATAGCAGCCTTGCCTGCTCTGATCCTGCAACGGGCCAATCC
CGGCCTGTACGACCTCTTTCAAAATGCTCTGATCAAAGCTGAAGAAACCATGCAACTGGCCACCAAATCC
TGCGAACTGATGGAGGCGGAAATCGCCCAGGGCAAGAACCCGTACGCGGATCTGATCACCTTGTCCAAGG
GCAATGACTGGAAGGTGCAGATGGGTGTCGGTGGCAACGACGCCGTCACCGCTAAAACCACCGTGGAGTC
GTCCAATGGCGATAACGGTGTGCCCTGGATCGGCGGGCAGGCCGGTGGCAGCGGGCAACCGGTGCTGGAG
TTCACTGGCGATATCGTCGAAGCCGGTTACAACATCAATATGAATCGTGCCGTCACTGATGCAAGCCCGG
TACCGGCAGCGTCGTCGACACGTTTATCCGAGATCTGGCCATACCCGGTCGATGCGCGTGACTGGACGGT
GGATGTGGTGGGCGAGAACATCGTCACCACCTGCGATACCTGCCGTAAGGACAGCATTCCCGGTACGGGG
CTGTTACCCAAGCTCTACCAGGAGTCCGCGACAGTCACCACCGACATCCAGAATTTGGTCAGCGGTGCGA
CACCACTTACCCTGACTAACCTCGACCAGATCACAGCGCCCGGCGTGGCCATCACCCGACAAGTGGTCGA
AGCGATTCGCGAGATGCCTGCATCGGAACAGAGCCTGATCATGGGCCGCCTGGTGTCTGAAATCAGTACC
GCGCGCACGGTAGAGAAGGCGCTATTTGCCCGAAGACTGCTACTTTCAGGACGACAAGTACCCGAGGTCT
ACGCCACCGAAGTCGCCCGCGAGCACGCCGACACCTCGATTGCCGAGCTCGATAAAGAAATCGAAAACCT
GCTGTTTGAAACCCGTGTGCGCAAAGAAGTGGTATCTGACACGGTTACCACATTACTCGAACGAGCAGCG
GCCAGACGACAGAGTTCCCTTACCGTGCCGGAAGTGCCGACCCTCGATCCCAACCCTTTGCGAGGTGGGC
GTGTTCAATAA
 Primer design