SecReT4
Protein ID: 77404834
T4SS name [ID]Tra_F [801]
Gene symboltraL
Locus tagRSP_4220
StrainRhodobacter sphaeroides 2.4.1
Repliconplasmid D [GenBank: NC_007490] [Browse all T4SS(s) in this replicon]
Location [Strand]67635..67925 [+]
Producthypothetical protein
Component typeTraL_F
UniProt IDQ3IUW9
KEGG IDrsp:RSP_4220
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 1.9e-18, Aligned region: 6..95
Protein Sequence: 96 a.a.     [Download]
>gi|77404834|ref|YP_345406.1| hypothetical protein RSP_4220 [Rhodobacter sphaeroides 2.4.1]
MQEKVIKIEQRLQEQGRILLFPIDEGLALLAPAGVGLAMQAAVAGIILGLVSYVLWKRIKGDGGLERILA
LTYWYLPAELSPMKSWPDSAVTMWRG
 
Nucleotide Sequence: 291 bp     [Download]
>gi|77404776|ref|NC_007490.1|:67635-67925 Rhodobacter sphaeroides 2.4.1 plasmid D, complete sequence
ATGCAGGAGAAAGTCATCAAGATCGAACAGAGACTGCAGGAGCAAGGCCGCATCCTGCTGTTTCCCATCG
ACGAGGGCCTGGCCCTTCTCGCACCCGCCGGGGTTGGCCTTGCCATGCAGGCTGCCGTTGCCGGCATCAT
CCTCGGCCTCGTGAGCTATGTGCTCTGGAAGCGCATCAAGGGTGACGGTGGCCTCGAGCGGATCCTCGCT
CTCACCTACTGGTATCTGCCCGCCGAGTTGAGCCCGATGAAATCGTGGCCGGACAGCGCCGTCACGATGT
GGAGGGGCTGA
 Primer design