SecReT4
Protein ID: 77404842
T4SS name [ID]Tra_F [801]
Gene symboltraP
Locus tagRSP_4229
StrainRhodobacter sphaeroides 2.4.1
Repliconplasmid D [GenBank: NC_007490] [Browse all T4SS(s) in this replicon]
Location [Strand]74001..74531 [+]
Productsignal peptidase I
Component typeTraF_F
UniProt IDQ3IUW1
KEGG IDrsp:RSP_4229
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 2.6e-24, Aligned region: 31..155
Protein Sequence: 176 a.a.     [Download]
>gi|77404842|ref|YP_345414.1| signal peptidase I [Rhodobacter sphaeroides 2.4.1]
MTLRDLARRSFMIGGSLFVVAGFWLLHNGRLTLNASHSLPEPAYLMWAWPKVIWKGAVISADPPAAYAAR
FDGLLFTKRVVGLPGDRIEHRDGAVCVAGECYPLALKDGAPFAPALAEGVIPDGHYAAFGSSADSLDSRY
ATVGLFARETIRAVGVGTTLVPHWKELKAWADAHGY
 
Nucleotide Sequence: 531 bp     [Download]
>gi|77404776|ref|NC_007490.1|:74001-74531 Rhodobacter sphaeroides 2.4.1 plasmid D, complete sequence
ATGACCCTGCGCGATCTCGCCCGGCGCAGCTTCATGATCGGAGGCTCGCTCTTCGTCGTGGCGGGCTTCT
GGCTCCTGCACAATGGCCGCCTCACCCTCAATGCCTCGCACTCTCTGCCCGAGCCCGCCTATCTCATGTG
GGCTTGGCCGAAGGTGATCTGGAAGGGCGCCGTGATCTCGGCCGATCCGCCCGCAGCCTATGCGGCACGG
TTCGACGGTCTGCTCTTCACCAAGCGCGTCGTCGGTCTGCCGGGCGACCGGATCGAGCATCGAGACGGTG
CGGTGTGCGTCGCAGGCGAGTGCTATCCGCTCGCGCTGAAGGATGGCGCACCCTTCGCGCCGGCGCTGGC
CGAGGGCGTGATCCCGGACGGGCATTACGCCGCCTTCGGCAGCTCGGCCGACAGTCTCGACAGCCGCTAC
GCCACGGTCGGCCTCTTCGCGCGGGAGACAATCCGCGCCGTGGGCGTCGGCACCACCCTTGTCCCTCATT
GGAAGGAGCTGAAGGCATGGGCGGACGCGCACGGATACTGA
 Primer design