SecReT4
Protein ID: 77404847
T4SS name [ID]Tra_F [801]
Gene symbol-
Locus tagRSP_4234
StrainRhodobacter sphaeroides 2.4.1
Repliconplasmid D [GenBank: NC_007490] [Browse all T4SS(s) in this replicon]
Location [Strand]78948..79346 [+]
Productthioredoxin domain-containing protein
Component typeTraF_F
UniProt IDQ3IUV6
KEGG IDrsp:RSP_4234
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 1.4e-08, Aligned region: 24..109
Protein Sequence: 132 a.a.     [Download]
>gi|77404847|ref|YP_345419.1| thioredoxin domain-containing protein [Rhodobacter sphaeroides 2.4.1]
MNRRTLILGAAAALAPLPAVADPSAPVGLILVGASWCPFCKGAAQALHAAAGPAGLPVLVASHDGRPIPP
FEEFVDARGHPLAAGVRQWPTLLFVHLPSQRVFATIEGFRNARAYLGQVRATLTAAREAGYA
 
Nucleotide Sequence: 399 bp     [Download]
>gi|77404776|ref|NC_007490.1|:78948-79346 Rhodobacter sphaeroides 2.4.1 plasmid D, complete sequence
ATGAACCGACGCACCCTGATCCTCGGGGCCGCGGCCGCGCTGGCACCCCTGCCTGCCGTCGCCGATCCCT
CCGCACCCGTGGGACTCATCCTCGTCGGCGCGAGCTGGTGCCCGTTCTGCAAGGGCGCTGCCCAAGCGCT
CCATGCCGCGGCCGGCCCGGCCGGGCTGCCGGTTCTGGTCGCGTCCCATGACGGCCGGCCGATCCCACCG
TTCGAGGAGTTCGTGGACGCCCGCGGCCATCCGCTCGCGGCGGGCGTCCGGCAATGGCCGACGCTCCTCT
TCGTCCATCTGCCCTCGCAGCGGGTCTTCGCCACCATCGAAGGCTTCCGCAACGCGCGGGCCTATCTCGG
GCAGGTCCGGGCCACCCTCACTGCAGCACGGGAGGCGGGCTATGCGTAA
 Primer design