SecReT4
Protein ID: 77404848
T4SS name [ID]Tra_F [801]
Gene symboltraF
Locus tagRSP_4235
StrainRhodobacter sphaeroides 2.4.1
Repliconplasmid D [GenBank: NC_007490] [Browse all T4SS(s) in this replicon]
Location [Strand]79339..80172 [+]
Producthypothetical protein
Component typeTraF_F
UniProt IDQ3IUV5
KEGG IDrsp:RSP_4235
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 1.2e-61, Aligned region: 39..265
Protein Sequence: 277 a.a.     [Download]
>gi|77404848|ref|YP_345420.1| hypothetical protein RSP_4235 [Rhodobacter sphaeroides 2.4.1]
MRKSVFAALIGASLGGSAALANGGAGSAYGYCRDEITTGWNFYCDPTRAKKEEKPKLPAAAAPAAQAPAA
PAEKSYTQKIEEYRKELDELKYRAVLEPSPENVQAYMEAQQKMSRMAASFTDQWQRILFRTPSLDINTRF
PMTQMGGSVYQDQMRVAREASLKDAAANLGFMVIVEDAAICGLCTPQLEVIRRMQEQYGIEPIVVTVDGS
FHPLFPNAVVDTGQLKALKLADSPRPTIALVEPRTGTVEPIGSGLLTEDTILERVHVVTQIPAGQRY
 
Nucleotide Sequence: 834 bp     [Download]
>gi|77404776|ref|NC_007490.1|:79339-80172 Rhodobacter sphaeroides 2.4.1 plasmid D, complete sequence
ATGCGTAAGAGCGTGTTCGCGGCCCTCATCGGCGCGTCTCTCGGCGGCTCGGCCGCGCTGGCGAACGGCG
GCGCGGGCTCGGCCTACGGCTACTGCCGCGACGAAATCACGACCGGCTGGAATTTCTACTGCGACCCCAC
GCGCGCGAAGAAGGAAGAGAAGCCGAAGCTGCCAGCCGCGGCCGCACCTGCGGCGCAGGCTCCCGCCGCA
CCGGCCGAGAAGAGCTACACCCAGAAGATCGAGGAATATCGCAAGGAGCTGGATGAGCTGAAGTATCGCG
CCGTGCTCGAGCCGTCGCCGGAGAATGTGCAGGCCTACATGGAGGCTCAGCAAAAGATGAGCCGGATGGC
CGCGAGCTTCACCGACCAGTGGCAGAGGATCCTCTTCCGCACGCCCTCGCTCGACATCAACACCCGCTTC
CCGATGACCCAGATGGGCGGCTCGGTCTATCAGGACCAGATGCGCGTGGCGCGCGAGGCCTCGTTGAAGG
ACGCGGCGGCAAATCTCGGCTTCATGGTGATCGTGGAGGATGCTGCGATCTGCGGCCTCTGCACGCCGCA
GCTCGAAGTCATCCGCAGGATGCAGGAGCAATATGGGATCGAGCCCATCGTCGTGACGGTGGACGGCTCG
TTCCATCCCCTCTTCCCGAACGCCGTGGTGGATACGGGCCAGCTCAAGGCGCTGAAGCTCGCGGACAGCC
CGCGCCCGACCATCGCTCTGGTCGAACCTCGCACCGGCACGGTCGAGCCGATCGGCTCGGGGCTTCTCAC
CGAGGACACGATCCTCGAGCGCGTCCATGTCGTGACGCAGATCCCCGCCGGCCAAAGATACTGA
 Primer design