SecReT4
Protein ID: 77459229
T4SS name [ID]Tfc [703]
Gene symbol-
Locus tagPfl01_3007
StrainPseudomonas fluorescens Pf0-1
Repliconchromosome [GenBank: NC_007492] [Browse all T4SS(s) in this replicon]
Location [Strand]3447766..3448308 [+]
ProductPilL protein
Component typeTfc2
UniProt IDQ3KBV9
KEGG IDpfo:Pfl01_3007
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 180 a.a.     [Download]
>gi|77459229|ref|YP_348736.1| unnamed protein product [Pseudomonas fluorescens Pf0-1]
MERFFTPVCLLGLLSACTAQIPTPLPPHPEIGSGSNQAPHSRGTAEESHPAELRYGRYTLVSTEPTTEQR
DLLAQIIDVSIPSSLSPSVQDALQYVLRRSGYSLCPATASVRVLFTRPLPAAHYRLGPLSLRNALQVLAG
PAWQLTTDEVSRSVCFEQQKTEAGVVRATPSSSHQAEARP
 
Nucleotide Sequence: 543 bp     [Download]
>gi|255961261|ref|NC_007492.2|:3447766-3448308 Pseudomonas fluorescens Pf0-1 chromosome, complete genome
ATGGAGCGTTTTTTCACCCCTGTCTGCCTACTGGGTTTGTTGAGCGCCTGCACCGCGCAAATCCCCACCC
CATTGCCGCCCCATCCAGAAATCGGCAGCGGCTCCAATCAGGCCCCGCACTCGAGGGGTACAGCCGAAGA
AAGCCATCCGGCGGAACTTCGTTATGGCCGCTACACGCTGGTCAGCACCGAGCCCACCACGGAACAACGC
GATCTTCTTGCCCAAATCATTGACGTGAGCATCCCGTCCAGTCTGAGTCCTTCGGTGCAGGATGCGTTGC
AGTACGTATTGCGACGCTCGGGCTATTCGCTCTGCCCCGCTACTGCGTCGGTGAGGGTACTCTTTACTCG
GCCCCTGCCCGCGGCTCATTACCGGCTCGGCCCGCTCTCTTTGCGCAACGCGCTACAAGTGCTAGCTGGG
CCCGCCTGGCAACTCACGACCGATGAAGTCAGCCGTTCGGTCTGCTTCGAACAGCAGAAAACGGAGGCCG
GCGTCGTGCGGGCCACACCAAGCTCATCCCATCAGGCGGAGGCACGTCCATGA
 Primer design