SecReT4
Protein ID: 77459232
T4SS name [ID]Tfc [703]
Gene symbol-
Locus tagPfl01_3010
StrainPseudomonas fluorescens Pf0-1
Repliconchromosome [GenBank: NC_007492] [Browse all T4SS(s) in this replicon]
Location [Strand]3449720..3450235 [+]
Productlytic transglycosylase catalytic subunit
Component typeTfc4
UniProt IDQ3KBV6
KEGG IDpfo:Pfl01_3010
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 171 a.a.     [Download]
>gi|77459232|ref|YP_348739.1| unnamed protein product [Pseudomonas fluorescens Pf0-1]
MLTMLAAQADELPPPAYQLAAHDADIPSTVLFAIALQESGIRVHGRLLPWPWTLNIAGNPYRFATRQAAC
HALLQALTQYDAKRVDAGLGQTNLGYHGQRFSSPCDALDPYRNLAVTAALLQEHHTATGDWVSAAGRFHR
PAGGTPAARYRAGFSRQLERLLVSFKQGTPP
 
Nucleotide Sequence: 516 bp     [Download]
>gi|255961261|ref|NC_007492.2|:3449720-3450235 Pseudomonas fluorescens Pf0-1 chromosome, complete genome
ATGCTGACGATGCTCGCAGCCCAGGCTGACGAACTTCCGCCGCCTGCCTACCAACTGGCGGCGCATGACG
CGGACATCCCTTCTACGGTGCTGTTCGCGATTGCCCTGCAGGAGAGCGGCATTCGGGTCCATGGCCGACT
GCTGCCCTGGCCTTGGACTCTGAACATAGCCGGTAACCCTTACCGCTTCGCCACTCGCCAGGCCGCCTGT
CACGCCTTGCTCCAGGCACTCACTCAGTATGACGCCAAGCGGGTCGACGCCGGACTTGGGCAAACCAACC
TGGGTTACCACGGACAACGTTTTTCCAGCCCCTGCGATGCCCTCGACCCGTACCGAAATCTCGCCGTGAC
CGCCGCGCTGTTGCAGGAGCATCACACCGCCACCGGTGACTGGGTGTCTGCTGCCGGACGCTTTCACCGC
CCGGCAGGAGGAACGCCGGCCGCGCGTTACCGCGCCGGATTTTCCCGGCAACTCGAACGGTTGCTGGTTT
CCTTCAAACAGGGCACACCGCCATGA
 Primer design