SecReT4
Protein ID: 77459234
T4SS name [ID]Tfc [703]
Gene symbol-
Locus tagPfl01_3012
StrainPseudomonas fluorescens Pf0-1
Repliconchromosome [GenBank: NC_007492] [Browse all T4SS(s) in this replicon]
Location [Strand]3450757..3452862 [+]
Producthypothetical protein
Component typeTfc6
UniProt IDQ3KBV4
KEGG IDpfo:Pfl01_3012
PDB IDNA
Domain hit(s) vs Pfam TraG-D_C [PF12696], Evalue: 1.1e-16, Aligned region: 503..633
TrwB_AAD_bind [PF10412], Evalue: 1.3e-08, Aligned region: 500..643
AAA_10 [PF12846], Evalue: 2.1e-08, Aligned region: 189..580
Protein Sequence: 701 a.a.     [Download]
>gi|77459234|ref|YP_348741.1| unnamed protein product [Pseudomonas fluorescens Pf0-1]
MAEHAMESKLRPAVELYTVAICIAAAVLCVYSPWAVALSPEIGLVAALAYALFGLIRLRQAWEVLRYRRN
IRRLPRYGLTSRQIPVSRKRLFMGRGFRWTRLHTQRLVEAQDPAVAHYVEQPTRYRLARGLERRLEHAPF
PFSTLARATAWDSAFNPLRPLPQVGGSPLLHGVEPDETEVSLPLGERVGHTLVLGTTRVGKTRLAEVYIT
QDIHRIEHEVVIVFDPKGDADLLKRMYVEAKRAGRDKEFYVFHLGWPEISARYNAVGRFGRISEVASRIA
GQLSGEGNSAAFREFAWRFVNIIARALIELGRRPDYLQIQRHVVNIDALFIEYAQQFFAKTDPKAWEVIV
QLEGKLTEKNIPRHMIGREKRVVAIEQYLAVKRVFDPVMDGLRSAVRYDRTYFDKIVASLLPLLEKLTTG
KTAQLLAPNYTDLDDPRPIFDWMQIIRKRGIVYVGLDALTDAEVAAAVGNSMFADLVSVAGHIYKHGIDH
GLPPSGNSSDKLPINLHADEFNELMGDEFIPLINKGGGAGIQVTAYTQTLSDIEARIGNRAKAGQVIGNF
NTLQMLRVRETATAELLTQQLPKVNVLTKTLVSGATDTSDPEAHTDFTSSSQDRVSSTSVPLIEPAHIVS
LPKGQMFSFQAGGQLWKVRMPLPKPSNDDAMPKDLQELTQRMRATYNTQAGQWWSASGGGPTTNFDLDQV
G
 
Nucleotide Sequence: 2106 bp     [Download]
>gi|255961261|ref|NC_007492.2|:3450757-3452862 Pseudomonas fluorescens Pf0-1 chromosome, complete genome
ATGGCCGAGCATGCAATGGAGTCCAAGCTCCGGCCAGCGGTGGAGCTATACACCGTAGCGATCTGCATCG
CTGCCGCGGTGTTGTGCGTGTACTCGCCCTGGGCTGTGGCCCTGTCACCCGAGATCGGTCTGGTTGCAGC
GCTGGCCTATGCCCTGTTCGGCCTTATCCGGCTGCGACAAGCCTGGGAGGTGCTGCGTTATCGGCGCAAT
ATCCGTCGGCTGCCCCGCTACGGGCTGACCAGTCGGCAGATTCCGGTCAGCCGCAAGCGTCTGTTCATGG
GCCGTGGCTTTCGCTGGACCCGCCTGCACACCCAACGTTTGGTTGAGGCCCAGGATCCGGCGGTCGCCCA
CTATGTCGAGCAACCGACCCGTTACCGTCTGGCCCGAGGACTCGAACGCCGCCTGGAACATGCACCGTTT
CCGTTCTCGACACTGGCCCGTGCCACCGCCTGGGACAGCGCCTTCAATCCGTTGCGCCCTTTGCCCCAAG
TAGGTGGCTCGCCGCTGTTGCATGGGGTGGAGCCTGATGAAACAGAAGTCAGTCTACCGCTGGGCGAACG
GGTCGGTCACACCCTGGTGCTCGGCACTACCCGTGTCGGCAAGACGCGACTCGCCGAGGTGTATATCACC
CAGGACATTCATCGCATCGAACATGAAGTGGTCATAGTCTTCGATCCGAAGGGCGATGCCGACCTGCTCA
AACGGATGTACGTTGAAGCCAAGCGGGCAGGTCGAGATAAGGAGTTTTATGTTTTCCATCTAGGCTGGCC
GGAGATCTCCGCTCGATACAATGCGGTGGGACGCTTCGGGCGTATCTCGGAAGTGGCGTCACGCATCGCC
GGGCAGCTCAGCGGCGAAGGTAACTCCGCGGCCTTTCGCGAGTTTGCCTGGCGTTTCGTCAACATCATCG
CCCGTGCCCTGATCGAGTTAGGCCGGCGTCCGGACTACTTGCAGATCCAACGGCATGTGGTCAACATCGA
CGCACTGTTCATCGAGTACGCCCAGCAGTTTTTCGCCAAGACCGACCCGAAGGCGTGGGAGGTGATCGTT
CAGCTCGAAGGCAAGCTCACCGAAAAGAACATTCCCCGGCATATGATCGGGCGCGAAAAGCGTGTGGTGG
CCATCGAACAGTACCTGGCGGTGAAGCGGGTATTTGATCCGGTCATGGACGGGCTGCGTTCGGCGGTACG
ATATGATCGTACTTACTTCGACAAAATCGTTGCCTCACTACTGCCGCTGCTGGAGAAACTCACCACCGGC
AAGACCGCCCAACTGCTGGCGCCAAACTACACCGACTTAGATGACCCGCGGCCAATCTTCGACTGGATGC
AGATCATCCGAAAACGCGGCATCGTCTACGTCGGTTTGGATGCTCTGACCGACGCCGAGGTGGCCGCCGC
TGTGGGCAACTCCATGTTCGCCGACTTGGTCTCGGTCGCCGGACACATTTACAAACACGGCATCGACCAT
GGCCTGCCCCCATCGGGTAACAGCAGTGACAAGTTGCCGATCAACCTGCACGCCGATGAGTTCAACGAGT
TGATGGGGGATGAATTCATCCCGCTGATCAATAAGGGCGGCGGTGCCGGTATTCAGGTAACCGCCTACAC
CCAGACCCTCAGTGATATCGAAGCACGTATCGGCAACCGCGCCAAAGCTGGCCAGGTTATTGGCAACTTC
AACACCCTGCAGATGCTGCGGGTGCGCGAAACCGCCACCGCTGAACTGCTCACTCAGCAATTGCCCAAGG
TCAACGTGCTGACCAAGACCCTGGTGTCGGGTGCCACCGACACCTCCGATCCGGAAGCCCATACGGACTT
CACTTCGTCCTCGCAGGACCGCGTCAGCAGCACCAGCGTGCCGTTGATCGAGCCTGCCCACATCGTCAGT
TTGCCCAAAGGGCAAATGTTCTCCTTCCAAGCCGGTGGGCAGCTCTGGAAAGTCCGCATGCCCTTACCAA
AACCCTCCAACGACGATGCCATGCCCAAGGACTTGCAGGAGCTCACCCAGCGAATGCGGGCCACCTACAA
CACGCAGGCGGGGCAATGGTGGAGCGCCAGTGGTGGCGGCCCAACAACAAACTTCGATCTGGATCAGGTG
GGGTAG
 Primer design