SecReT4
Protein ID: 77459235
T4SS name [ID]Tfc [703]
Gene symbol-
Locus tagPfl01_3013
StrainPseudomonas fluorescens Pf0-1
Repliconchromosome [GenBank: NC_007492] [Browse all T4SS(s) in this replicon]
Location [Strand]3452953..3453684 [+]
Producthypothetical protein
Component typeTfc8
UniProt IDQ3KBV3
KEGG IDpfo:Pfl01_3013
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 2.5e-67, Aligned region: 47..240
Protein Sequence: 243 a.a.     [Download]
>gi|77459235|ref|YP_348742.1| unnamed protein product [Pseudomonas fluorescens Pf0-1]
MATSAQNTPPQPIQRPGLIISTISLVLRVIGLLIASLLFSILIEFAGLLLFWGDQGWLHSQAMLTSELGW
LSEHFKSSLLIQQPGPTIVQWLDLLNQWLLVKTGFADFAQQARVSSMGNSFWGWINQFYVSIEDFVLAAV
YVTFTFMVRLTILVLATPLFLLASLTGFIDGLMRRDLRKFGAGRESSFVYHRAKRAVIPLLIVPWIIYLS
LPFSLNPMVVFLPCAVMLGITVAITASTFKKYL
 
Nucleotide Sequence: 732 bp     [Download]
>gi|255961261|ref|NC_007492.2|:3452953-3453684 Pseudomonas fluorescens Pf0-1 chromosome, complete genome
ATGGCGACTTCCGCCCAGAACACGCCACCACAACCGATCCAGCGTCCAGGACTGATCATCTCGACGATCA
GCCTGGTACTGCGCGTCATCGGTTTGCTGATCGCCTCGTTGCTGTTCTCGATCCTGATCGAGTTCGCTGG
TTTGCTGCTGTTCTGGGGTGATCAGGGCTGGCTGCATAGTCAGGCCATGCTAACCAGTGAATTAGGCTGG
CTCAGCGAGCACTTCAAATCTTCACTTCTCATCCAACAGCCTGGGCCAACGATTGTCCAGTGGCTGGATT
TACTCAATCAGTGGCTACTGGTCAAAACTGGCTTTGCAGATTTTGCCCAGCAGGCGCGGGTATCGAGCAT
GGGCAACAGCTTCTGGGGGTGGATCAATCAGTTTTACGTGAGCATTGAAGATTTTGTGCTGGCGGCGGTG
TATGTGACCTTTACCTTCATGGTGCGCCTGACCATTCTGGTCCTGGCCACACCCTTGTTTCTGCTGGCCT
CTCTCACCGGTTTTATCGATGGTTTGATGCGTCGCGACCTGCGCAAATTTGGCGCGGGGCGAGAAAGCAG
CTTTGTCTATCACCGCGCCAAGCGCGCAGTGATACCACTGCTGATCGTGCCCTGGATCATTTACCTATCC
CTGCCCTTTTCGCTCAATCCTATGGTCGTATTTTTGCCTTGTGCTGTAATGCTTGGCATCACAGTAGCAA
TCACGGCAAGTACATTTAAGAAATATCTCTGA
 Primer design