SecReT4
Protein ID: 77459237
T4SS name [ID]Tfc [703]
Gene symbol-
Locus tagPfl01_3015
StrainPseudomonas fluorescens Pf0-1
Repliconchromosome [GenBank: NC_007492] [Browse all T4SS(s) in this replicon]
Location [Strand]3454633..3454968 [+]
Producthypothetical protein
Component typeTfc9
UniProt IDQ3KBV1
KEGG IDpfo:Pfl01_3015
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 1.1e-31, Aligned region: 21..100
Protein Sequence: 111 a.a.     [Download]
>gi|77459237|ref|YP_348744.1| unnamed protein product [Pseudomonas fluorescens Pf0-1]
MPTTVFRCFLLLSLAIVHGSSYAASAHEQSQLSLILQQLDIIERLATQAETASTAEPNDRYRFDYPRLTQ
DIQRIRQGVQSYLFPSRAQPRDPTELVGDYRLDAPTAEPSP
 
Nucleotide Sequence: 336 bp     [Download]
>gi|255961261|ref|NC_007492.2|:3454633-3454968 Pseudomonas fluorescens Pf0-1 chromosome, complete genome
ATGCCAACTACCGTCTTTCGCTGCTTTTTACTACTCTCGCTGGCTATCGTCCATGGCAGTAGCTACGCCG
CCTCCGCCCATGAACAGAGTCAGCTCAGTCTGATTCTGCAGCAACTCGACATTATCGAACGCCTTGCGAC
ACAAGCAGAGACAGCTAGCACGGCTGAACCCAACGATCGCTATCGATTCGACTACCCCCGACTGACCCAG
GACATTCAGCGCATCCGTCAAGGTGTACAGAGCTATCTGTTCCCTTCCCGTGCGCAACCCCGAGATCCCA
CTGAACTGGTCGGTGATTACCGCCTCGACGCTCCGACTGCGGAGCCCTCGCCATGA
 Primer design