SecReT4
Protein ID: 77459240
T4SS name [ID]Tfc [703]
Gene symbol-
Locus tagPfl01_3018
StrainPseudomonas fluorescens Pf0-1
Repliconchromosome [GenBank: NC_007492] [Browse all T4SS(s) in this replicon]
Location [Strand]3455601..3456014 [+]
Producthypothetical protein
Component typeTfc11
UniProt IDQ3KBU8
KEGG IDpfo:Pfl01_3018
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 1.1e-45, Aligned region: 10..127
Protein Sequence: 137 a.a.     [Download]
>gi|77459240|ref|YP_348747.1| unnamed protein product [Pseudomonas fluorescens Pf0-1]
MNDTIERVADGTLVFLPERLNRDPAVLRGLTNDEIWVALGAGAVIGLLLGVPLAIATATIAVAPTSMIAG
MALVLLAGGTLLRRTKRARPETWLYRKLEWVLASRWRLGRGSLILHSGAWTVRRSRRLRPALSRWQL
 
Nucleotide Sequence: 414 bp     [Download]
>gi|255961261|ref|NC_007492.2|:3455601-3456014 Pseudomonas fluorescens Pf0-1 chromosome, complete genome
ATGAACGACACTATCGAACGCGTTGCCGACGGCACCTTGGTCTTTCTGCCCGAGCGACTCAATCGTGATC
CCGCCGTATTACGCGGTTTGACCAATGATGAGATTTGGGTGGCGCTCGGCGCCGGCGCCGTCATTGGCCT
GCTGCTGGGCGTTCCCCTGGCAATCGCCACCGCTACCATTGCCGTGGCGCCGACCAGCATGATCGCGGGC
ATGGCGCTGGTGTTACTTGCCGGCGGCACACTACTGCGTCGGACCAAACGGGCCCGCCCCGAGACCTGGT
TGTACCGCAAGCTCGAATGGGTACTGGCGAGTCGTTGGCGCCTGGGGCGCGGAAGTTTGATTCTCCACTC
TGGCGCCTGGACGGTTCGCCGTTCGCGTCGACTGCGCCCGGCCCTGTCCCGGTGGCAACTATGA
 Primer design