SecReT4
Protein ID: 77459249
T4SS name [ID]Tfc [703]
Gene symbol-
Locus tagPfl01_3027
StrainPseudomonas fluorescens Pf0-1
Repliconchromosome [GenBank: NC_007492] [Browse all T4SS(s) in this replicon]
Location [Strand]3463882..3465264 [+]
Producthypothetical protein
Component typeTfc22
UniProt IDQ3KBT9
KEGG IDpfo:Pfl01_3027
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 460 a.a.     [Download]
>gi|77459249|ref|YP_348756.1| unnamed protein product [Pseudomonas fluorescens Pf0-1]
MSRLLARPWLGAMSLLLCGLLAMATHAHAAEGDYRLGTQGEVLDDRVMYTIGGGSTVGSPSSLYRPSGLG
VGGSWRANMMCGNMSLTNTLQNQLNGVTEGFQQIMGSIVQNATQAVMSLPALIIQRANPGLYELLSNGVM
QGRIDFDRSKLTCQAMAEKMADKVGQAGWGALAKNQEMQVNLEQTGGDAVAAVKNTEAHNGNNGVSWVGG
SKAGGNGQTPIRVTADVVRAGYNLLHNRSVDDSASISSSDCLGGAICQTWTSPQEESEWAVRVLGETEVA
TCDTCETLRATAGSGLTPLIQEAYSERLKALQELLSGSLPPTPDNLAKASSPMLPVTRGVVEALRDDPDQ
DLLARRLASETALSSVLDKALLLLRTLLAGSHEPNIASAEPAQIALTKNIDALEREIRLLQTELQVRQML
TTNTASLVLDRHAGGADASRTVEQGDPEPGRLNDADTRRK
 
Nucleotide Sequence: 1383 bp     [Download]
>gi|255961261|ref|NC_007492.2|:3463882-3465264 Pseudomonas fluorescens Pf0-1 chromosome, complete genome
ATGAGTCGGCTTCTCGCACGACCATGGTTGGGCGCGATGAGTCTGTTGCTCTGTGGACTGCTCGCCATGG
CTACTCATGCCCACGCAGCCGAGGGCGATTACCGCCTGGGCACTCAAGGCGAAGTACTCGACGACCGAGT
GATGTACACCATTGGTGGCGGCTCGACAGTCGGCTCACCGAGTTCGCTCTACCGACCCAGCGGTCTCGGT
GTCGGCGGGTCCTGGCGCGCGAACATGATGTGCGGAAACATGAGCCTCACCAACACCCTGCAAAACCAGC
TGAACGGCGTCACCGAAGGTTTCCAGCAGATCATGGGCAGCATCGTGCAGAACGCGACCCAAGCGGTGAT
GTCGCTGCCGGCGTTGATCATCCAGCGCGCCAACCCCGGTCTCTATGAGTTGCTCAGTAACGGGGTGATG
CAGGGGCGCATCGACTTCGATCGTTCCAAGCTGACCTGCCAGGCCATGGCAGAGAAGATGGCGGACAAAG
TTGGTCAAGCCGGTTGGGGTGCGCTGGCCAAAAACCAGGAGATGCAGGTCAATCTGGAGCAAACCGGCGG
TGATGCGGTGGCAGCGGTGAAAAACACCGAGGCCCATAACGGCAACAATGGGGTGTCCTGGGTCGGCGGT
TCGAAGGCCGGAGGGAACGGACAGACGCCCATTCGAGTGACCGCCGACGTGGTCCGTGCAGGCTATAACC
TGCTGCATAACCGGTCGGTGGATGACAGCGCCTCGATCAGTAGCAGCGACTGCTTAGGCGGGGCTATTTG
CCAGACATGGACCTCGCCCCAAGAGGAATCCGAATGGGCCGTTCGGGTGTTGGGCGAGACCGAAGTCGCG
ACCTGCGACACATGCGAAACCCTGCGTGCTACCGCTGGCAGTGGATTGACGCCGTTGATTCAGGAGGCCT
ATAGCGAACGCCTGAAGGCCCTGCAGGAGTTGCTGTCTGGCTCTCTCCCGCCTACCCCTGACAACCTGGC
TAAAGCCTCCAGCCCGATGTTACCGGTGACCCGAGGCGTGGTCGAAGCCCTGCGTGACGATCCCGACCAG
GATCTGCTGGCACGGCGTTTGGCCAGTGAGACTGCCCTGTCCAGCGTACTCGACAAGGCGTTGCTGCTAC
TGCGTACGCTACTGGCGGGCAGTCACGAACCGAACATCGCCTCCGCCGAACCGGCCCAGATCGCCTTGAC
GAAAAACATCGACGCCTTGGAGCGCGAAATTCGCCTGCTGCAGACCGAGCTGCAGGTCAGGCAGATGCTG
ACGACCAATACCGCCAGCCTGGTGCTCGACCGGCATGCCGGTGGCGCTGATGCTTCGCGCACCGTCGAGC
AAGGCGACCCTGAGCCCGGTCGACTTAATGATGCTGACACCAGGCGCAAGTGA
 Primer design