SecReT4
Protein ID: 77748643
T4SS name [ID]Tfc [750]
Gene symbol-
Locus tagXAC2272
StrainXanthomonas axonopodis pv. citri str. 306
Repliconchromosome [GenBank: NC_003919] [Browse all T4SS(s) in this replicon]
Location [Strand]2656836..2657828 [+]
Producthypothetical protein
Component typeTfc13
UniProt IDQ8PKA3
KEGG IDxac:XAC2272
PDB IDNA
Domain hit(s) vs Pfam DUF3438 [PF11920], Evalue: 2.9e-123, Aligned region: 12..300
Protein Sequence: 330 a.a.     [Download]
>gi|77748643|ref|NP_642589.2| unnamed protein product [Xanthomonas axonopodis pv. citri str. 306]
MKRTHPSTPLLAFALWATLWLGDTPTAHAVQILRWERMPLAVPMRVGEERVVFIDRNVRVGVPNAIADRL
RVQSAGGAIYLKASEAIEPTRLQLQDADSGALVLIDIAAEPAQDGQAPLAPVRIAFGDAPGPRYGAGDRA
SDTDTGYDGQPADALSPDASQRLRHETPVAVVLTRYAAQSLYAPLRTVESARGVTPARLRRGLDLDTLAP
ALPVRAQALAAWRLDDQWVTAIRLTNTSPRWVDLDPRMLIGDFVAATFQHPGLGPAGDATDTTVLYLVTR
GRGLGEALLPRISRIDEARNLPAPATEHSTEPAPVPAVAPQPPSGAPHEK
 
Nucleotide Sequence: 993 bp     [Download]
>gi|21240774|ref|NC_003919.1|:2656836-2657828 Xanthomonas axonopodis pv. citri str. 306 chromosome, complete genome
ATGAAGCGCACCCATCCCTCTACTCCCCTGTTGGCATTCGCTCTGTGGGCGACGCTCTGGCTGGGCGATA
CGCCCACGGCCCATGCGGTGCAGATCCTGCGCTGGGAACGCATGCCGCTCGCGGTACCTATGCGCGTGGG
CGAAGAGCGCGTGGTCTTCATCGACCGCAACGTGCGCGTGGGCGTGCCCAACGCGATCGCCGATCGGCTG
CGCGTGCAGAGCGCGGGCGGCGCGATCTACCTCAAGGCGAGCGAGGCAATAGAGCCCACGCGGCTGCAGC
TGCAGGACGCCGACAGCGGCGCGCTGGTCCTGATCGACATCGCCGCCGAACCGGCCCAGGACGGCCAGGC
GCCGCTGGCGCCGGTGCGCATCGCCTTCGGCGATGCGCCCGGGCCGCGCTATGGCGCGGGCGACCGGGCA
TCAGACACCGACACAGGTTACGACGGGCAACCCGCCGATGCGCTCTCGCCCGATGCATCCCAGCGCCTGC
GCCACGAAACGCCGGTCGCCGTGGTGCTCACCCGCTATGCGGCGCAGAGCCTCTATGCGCCGCTGCGCAC
CGTGGAGTCCGCGCGCGGGGTGACCCCGGCGCGCCTGCGCCGCGGGCTCGATCTGGACACGCTCGCGCCC
GCCCTGCCGGTGCGCGCGCAGGCGCTGGCCGCCTGGCGCCTGGACGACCAATGGGTGACCGCGATCCGCC
TGACCAACACCTCGCCGCGCTGGGTGGACCTCGACCCGCGCATGCTCATCGGCGATTTCGTTGCGGCCAC
GTTCCAGCACCCGGGACTGGGACCGGCGGGCGATGCGACCGACACCACCGTGCTCTATCTGGTGACGCGC
GGCCGCGGACTGGGCGAGGCGCTGCTGCCGCGCATCAGCCGCATCGACGAGGCGCGGAACCTGCCGGCGC
CCGCGACCGAGCACTCGACCGAGCCCGCGCCCGTTCCAGCGGTCGCACCGCAGCCGCCTTCGGGAGCCCC
CCATGAAAAGTAA
 Primer design