SecReT4
Protein ID: 77748644
T4SS name [ID]Tfc [750]
Gene symbol-
Locus tagXAC2274
StrainXanthomonas axonopodis pv. citri str. 306
Repliconchromosome [GenBank: NC_003919] [Browse all T4SS(s) in this replicon]
Location [Strand]2659780..2662761 [+]
Producthypothetical protein
Component typeTfc16
UniProt IDQ8PKA1
KEGG IDxac:XAC2274
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 7.3e-65, Aligned region: 92..372
AAA_10 [PF12846], Evalue: 3.8e-46, Aligned region: 566..904
Protein Sequence: 993 a.a.     [Download]
>gi|77748644|ref|NP_642591.2| unnamed protein product [Xanthomonas axonopodis pv. citri str. 306]
MPRPPRWRWSERAAGALQRLRSGVAGARQTSTGPADPASPDAPDAPDAPDAWAAHIARLAEHGIRAPGAH
ARPADSPRATEDDERALYGVSPSFVDMLPWAEFLPGSRSMLLDDGVSVAAFYELVPIGTEGREMAWLWRA
RDALENALQDAFDELDDQPWVVQLYAQDEASWDRYLRGLDAYVQPRARGTAFTAFYQRFFAHHLRAIAKP
GGLFEDSAVTRLPWRGQARRVRMVVYRRIPAGATRRRGLSPEQALATVCDRLQGGLANAGVRAERLGAAD
VHAWLLRWFNPCPTLLGDTALDRERFYELTRYPEATEATEQVEEGEIELASGTDFAQRLFFGAPRSDVAH
GLWWFDGMPHRAVVMDRLRNAPGTGHLTGETRKGDAINALFDQMPEDTVMCLTLVATPQDVLESHLNHLA
RKAVGETLASEQTRRDVQEARGLIGSAHKLYRGALAFYLRGRDLEQLDERGVQLANVMLGAGLQPVREDD
EVAPLNTYLRWLPCVFDPAKDTRQWYTQLMFVQHAANLAPVWGRGRGTGHPGITLFNRGGDAVTFDPLNR
LDRQMNAHLFLFGPTGSGKSATLNNLLNQVMAIYRPRLFVVEAGNSFGLFGDFAARLGLTVNRVRLAPGA
GVSLAPFADARRLVDTPSQVRTLDADALDEAPELQGAAPEGDEQRDVLGELEITARLMITGGEDKEEARM
TRADRSLIRQCILDAARQCTAAGRTVLSRDVRDALRERAGDLNLPDTRRARLLEMADAMDMFCQGADGEM
FDRAGTPWPEADITIVDLATFAREGYNAQLSVAYISLINTVNNIAERDQFLGRPIINVTDEGHIITKNPL
LAPYVVKITKMWRKLGAWYWLATQNLDDLPRAAEPMLNMIEWWICLSMPPDEVEKIARFRELNAAQKALM
LSARKEAGKFTEGVVLSKSMELLFRAVPPSLYLAMAMTEPEEKAERFALMREHGISELDAAILVAERIDR
ARGIEPLAHPSLD
 
Nucleotide Sequence: 2982 bp     [Download]
>gi|21240774|ref|NC_003919.1|:2659780-2662761 Xanthomonas axonopodis pv. citri str. 306 chromosome, complete genome
ATGCCGCGGCCGCCGCGCTGGCGCTGGTCCGAACGCGCGGCGGGGGCGCTGCAGCGCCTGCGCAGCGGCG
TCGCGGGGGCCAGGCAGACCTCCACCGGGCCTGCCGACCCCGCCTCTCCAGACGCCCCAGATGCCCCGGA
TGCCCCGGATGCCTGGGCCGCCCACATTGCCCGGCTTGCCGAGCACGGCATTCGCGCGCCCGGCGCCCAC
GCACGCCCCGCGGATTCGCCGCGTGCCACCGAGGACGACGAGCGTGCGCTCTACGGCGTATCGCCGTCCT
TCGTGGACATGCTGCCCTGGGCGGAGTTCCTGCCCGGGTCGCGCAGCATGCTGCTGGACGACGGCGTGTC
CGTCGCCGCGTTCTACGAGCTCGTGCCGATCGGCACGGAGGGCCGCGAGATGGCATGGCTGTGGCGGGCC
CGCGACGCGCTGGAGAACGCGCTGCAGGACGCGTTCGACGAACTGGACGACCAGCCCTGGGTGGTGCAGC
TCTACGCGCAGGACGAAGCCAGTTGGGACCGCTACCTGCGGGGACTGGACGCCTATGTGCAGCCGCGTGC
GCGCGGCACGGCTTTCACGGCTTTCTACCAGCGCTTCTTCGCGCACCACCTGCGCGCGATCGCCAAACCC
GGCGGCTTGTTCGAGGACAGCGCCGTGACGCGCCTGCCCTGGCGCGGGCAGGCGCGCCGCGTGCGCATGG
TGGTCTATCGGCGCATTCCCGCTGGCGCCACCCGGCGCCGCGGCCTGTCGCCAGAGCAGGCGCTGGCCAC
GGTCTGCGATCGCCTGCAGGGCGGTCTCGCGAACGCGGGCGTGCGCGCCGAGCGCCTCGGCGCGGCCGAC
GTCCATGCCTGGCTGCTGCGCTGGTTCAACCCGTGCCCGACACTGCTCGGCGACACCGCCCTGGACCGGG
AACGCTTCTACGAGCTGACGCGCTATCCGGAAGCAACCGAGGCAACCGAACAAGTCGAGGAAGGCGAGAT
CGAACTCGCGAGCGGCACAGATTTCGCGCAACGCCTTTTTTTCGGCGCGCCGCGCTCCGACGTCGCGCAT
GGGCTTTGGTGGTTCGACGGCATGCCGCACCGCGCGGTGGTGATGGACCGCCTGCGCAACGCGCCGGGCA
CGGGGCACCTGACCGGTGAGACGCGCAAGGGTGATGCGATCAACGCGCTCTTCGACCAAATGCCCGAGGA
CACGGTGATGTGCCTGACGCTGGTCGCGACGCCGCAGGACGTGCTCGAATCCCACCTCAACCATTTGGCC
CGCAAGGCCGTGGGCGAGACCCTGGCGTCCGAGCAGACGCGCCGTGATGTGCAGGAAGCGCGCGGGCTGA
TCGGCAGCGCACACAAACTTTATCGCGGCGCCCTCGCCTTCTACCTGCGCGGCCGGGATCTGGAGCAGCT
GGACGAGCGCGGCGTGCAACTCGCGAACGTGATGCTGGGCGCCGGCCTGCAGCCGGTGCGCGAGGACGAC
GAGGTGGCGCCCCTCAACACCTATCTGCGCTGGCTGCCCTGCGTGTTCGATCCGGCGAAGGACACGCGCC
AGTGGTACACGCAGCTCATGTTCGTGCAGCATGCGGCCAACCTCGCGCCCGTCTGGGGACGCGGCCGGGG
CACGGGCCATCCTGGCATCACGCTGTTCAACCGCGGAGGCGATGCGGTCACCTTCGATCCGCTCAACCGG
CTGGACCGGCAGATGAACGCGCATCTGTTCCTGTTCGGCCCCACCGGCTCGGGCAAGAGCGCCACGCTCA
ACAACCTGCTCAACCAGGTGATGGCGATCTACCGGCCGCGTCTTTTCGTGGTCGAGGCGGGCAACTCCTT
CGGGCTGTTCGGCGACTTCGCGGCGCGCCTTGGCCTCACGGTGAACCGCGTGCGGCTCGCCCCGGGCGCG
GGCGTCAGCCTGGCCCCGTTCGCCGACGCGCGGCGCCTGGTGGACACGCCCAGCCAGGTCCGCACACTCG
ATGCCGATGCCCTCGACGAGGCACCGGAGTTACAAGGCGCCGCGCCGGAAGGCGACGAGCAGCGCGACGT
GCTGGGCGAGCTGGAGATCACCGCCCGGCTGATGATCACCGGAGGCGAGGACAAGGAGGAAGCGCGCATG
ACGCGCGCGGACCGCAGCCTGATCCGCCAGTGCATCCTCGACGCCGCCCGCCAGTGCACTGCGGCCGGCC
GCACCGTGCTCTCGCGCGACGTGCGCGATGCGCTGCGCGAGCGCGCGGGCGACCTCAACCTGCCGGACAC
CCGGCGCGCGCGCCTGCTGGAGATGGCGGACGCGATGGACATGTTCTGTCAGGGCGCGGACGGCGAGATG
TTCGACCGCGCCGGCACGCCCTGGCCCGAGGCCGACATCACCATCGTGGACCTCGCCACCTTCGCCCGCG
AGGGCTACAACGCGCAGCTGTCGGTAGCCTACATCTCCCTCATCAACACCGTGAACAACATCGCCGAGCG
CGACCAGTTCCTCGGCAGGCCGATCATCAACGTGACCGACGAGGGCCACATCATCACGAAGAACCCGCTG
CTCGCGCCCTACGTGGTGAAGATCACCAAGATGTGGCGCAAGCTCGGCGCCTGGTACTGGCTGGCCACCC
AGAACCTCGACGACCTGCCCCGCGCCGCCGAGCCCATGCTCAACATGATCGAGTGGTGGATCTGCCTGTC
GATGCCGCCCGACGAGGTGGAGAAGATCGCGCGGTTCCGCGAACTCAACGCCGCGCAGAAGGCGCTGATG
CTGTCTGCCCGCAAAGAGGCAGGCAAGTTCACCGAGGGGGTCGTCCTCTCGAAGTCCATGGAACTGCTCT
TCAGGGCGGTGCCGCCCAGCCTGTACCTCGCCATGGCGATGACCGAGCCCGAGGAGAAGGCCGAGCGCTT
CGCGCTGATGCGGGAGCACGGCATCAGCGAACTGGATGCCGCGATCCTCGTCGCAGAGCGGATCGACCGC
GCGCGCGGCATCGAGCCGCTGGCGCACCCTTCCCTGGACTGA
 Primer design