SecReT4
Protein ID: 77761186
T4SS name [ID]Tfc [683]
Gene symbol-
Locus tagXC_2034
StrainXanthomonas campestris pv. campestris str. 8004
Repliconchromosome [GenBank: NC_007086] [Browse all T4SS(s) in this replicon]
Location [Strand]2450114..2451040 [-]
Producthypothetical protein
Component typeTfc13
UniProt IDQ4UV28
KEGG IDxcb:XC_2034
PDB IDNA
Domain hit(s) vs Pfam DUF3438 [PF11920], Evalue: 2.9e-121, Aligned region: 7..287
Protein Sequence: 308 a.a.     [Download]
>gi|77761186|ref|YP_243115.2| hypothetical protein XC_2034 [Xanthomonas campestris pv. campestris str. 8004]
MKHPVLALLGLLAVASAPVAQALEVMRWERMPLAVALKVGQERIVFIDRNVRVGVPAGVGERLRVQSAGG
AVYLRANEPIEPTRLQLQDTDTGALILLDIAAEPAKGGEPALEPVRIVEGDVPSARSGDQPTDADEVPAP
ANRQAAAQSARRETPISVVLTRFAAQNLYAPLRTVEPLPGVMRVNLRRDLDLGTLIPTLPVRATALASWR
LEDQWVTAVRLTNTDAGWITLDPRVLQGDFLTATFQHEALGPRGTPEDTTVLYLMTRGRGITQSLLPALH
RFDPATHLPQPEASVEDPKDGKEAPHAQ
 
Nucleotide Sequence: 927 bp     [Download]
>gi|66766352|ref|NC_007086.1|:c2451040-2450114 Xanthomonas campestris pv. campestris str. 8004 chromosome, complete genome
ATGAAGCACCCTGTACTCGCGCTGCTGGGACTGCTGGCCGTGGCCTCGGCTCCCGTCGCCCAGGCCTTGG
AGGTTATGCGCTGGGAACGCATGCCGCTTGCGGTGGCGCTGAAGGTCGGCCAGGAACGCATCGTGTTTAT
CGACCGGAACGTCCGCGTGGGCGTGCCTGCGGGTGTGGGCGAGCGCCTGCGCGTGCAGAGCGCGGGCGGC
GCGGTGTATCTGCGCGCGAACGAGCCGATCGAACCCACGCGGCTGCAACTGCAAGACACCGACACCGGGG
CATTGATCCTGCTGGACATTGCTGCCGAGCCGGCCAAGGGTGGCGAGCCTGCGCTGGAGCCGGTGCGCAT
CGTCGAGGGCGATGTGCCCTCCGCGCGCTCCGGCGATCAGCCGACCGATGCCGACGAAGTGCCAGCACCC
GCCAATCGCCAGGCGGCCGCGCAGTCAGCCCGGCGCGAAACGCCAATCTCGGTAGTCCTTACACGCTTTG
CCGCGCAGAACCTATACGCACCGCTGCGCACGGTCGAGCCGCTGCCGGGCGTCATGCGGGTCAACCTGCG
CCGTGACCTGGACCTCGGCACCTTGATTCCGACACTGCCGGTGCGCGCCACCGCACTCGCCTCGTGGCGG
CTGGAAGACCAATGGGTGACGGCCGTGCGCCTCACCAACACCGACGCCGGCTGGATCACGCTAGACCCGC
GCGTGCTGCAAGGCGATTTCCTCACTGCCACCTTCCAGCATGAGGCACTCGGCCCGCGCGGCACGCCCGA
GGACACCACCGTCCTGTACCTGATGACGCGCGGGCGAGGCATCACGCAGTCGCTTTTGCCCGCCCTCCAC
CGCTTCGACCCGGCCACGCATTTGCCGCAGCCGGAAGCCAGCGTCGAGGATCCGAAGGACGGCAAGGAGG
CTCCCCATGCGCAGTAA
 Primer design