SecReT4
Protein ID: 77993231
T4SS name [ID]Trb [71]
Gene symboltrbB
Locus tagpB8_014
StrainIncP-1beta multiresistance plasmid pB8
Repliconplasmid pB8 [GenBank: NC_007502] [Browse all T4SS(s) in this replicon]
Location [Strand]11634..12596 [+]
ProductATPase
Component typeTrbB
UniProt IDQ4LCF8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.7e-86, Aligned region: 27..295
FtsK_SpoIIIE [PF01580], Evalue: 8.4e-08, Aligned region: 139..195
AAA_10 [PF12846], Evalue: 1.1e-06, Aligned region: 150..198
AAA_19 [PF13245], Evalue: 1.2e-05, Aligned region: 141..189
AAA_16 [PF13191], Evalue: 1.6e-05, Aligned region: 140..176
AAA_29 [PF13555], Evalue: 4.5e-05, Aligned region: 148..171
DUF87 [PF01935], Evalue: 4.9e-05, Aligned region: 150..190
Protein Sequence: 320 a.a.     [Download]
>gi|77993231|ref|YP_358821.1| ATPase [uncultured bacterium]
MTDQKPEHNSIKERAKKKLERDMGPELLAALNDPKTVEIMLNADGKLWLERLGEPMKCIGTLRVAQAQAI
IETIAGYHGKEVTRSKPILEGELPLDGSRFAGQLPPVVPAPTFAIRKKAVAIFTLDQYVERGIMTAPQRE
ALIAAVRAHRNILVIGGTGSGKTTLVNAIINEMVIQDPTERVFIIEDTGEIQCAAENYVQYHTSIDVNMT
ALLKTTLRMRPDRILVGEVRGPEALDLLMAWNTGHEGGAATLHANNAKAGLDRLAMLISMHPDSPKPIEP
LIGEAVHVVVHIARVEGSRRIQEILEVSGFANGQYITKTL
 
Nucleotide Sequence: 963 bp     [Download]
>gi|77993219|ref|NC_007502.1|:11634-12596 Uncultured bacterium IncP-1beta multiresistance plasmid pB8
ATGACCGACCAGAAACCAGAACACAACAGCATCAAGGAACGGGCGAAGAAGAAGCTCGAACGCGACATGG
GGCCGGAGCTGCTGGCCGCCCTCAACGATCCCAAGACCGTTGAAATCATGCTCAACGCGGACGGCAAGCT
CTGGCTCGAACGCCTGGGCGAGCCGATGAAGTGCATCGGCACGCTGCGCGTCGCGCAGGCGCAAGCCATC
ATCGAAACCATCGCGGGCTACCACGGCAAGGAAGTCACGCGCTCCAAGCCGATCCTGGAAGGCGAGCTGC
CCCTTGATGGCAGTCGCTTCGCCGGCCAGCTCCCGCCGGTTGTGCCCGCACCCACCTTCGCCATTCGGAA
GAAGGCCGTCGCCATCTTCACGCTCGATCAGTACGTCGAACGCGGAATCATGACCGCGCCGCAGCGCGAG
GCATTGATTGCAGCGGTGCGCGCGCACCGGAACATCCTTGTGATCGGCGGCACCGGCTCGGGCAAGACCA
CGCTGGTGAACGCGATCATCAACGAGATGGTGATTCAAGACCCGACCGAGCGGGTTTTCATCATCGAGGA
CACCGGCGAAATCCAGTGCGCCGCCGAGAACTACGTCCAGTACCACACCAGCATCGACGTGAACATGACG
GCGCTGCTGAAAACCACCCTCCGCATGCGCCCCGACCGAATCCTGGTCGGCGAGGTGCGCGGCCCCGAAG
CCCTTGATCTGTTGATGGCCTGGAACACCGGGCACGAAGGAGGTGCTGCAACCCTGCACGCAAACAACGC
CAAAGCTGGATTGGATCGGCTCGCCATGCTCATCAGCATGCACCCCGATTCCCCGAAACCCATTGAACCG
CTTATCGGCGAGGCGGTTCACGTGGTTGTTCATATCGCCCGCGTCGAAGGCTCGCGGCGCATCCAGGAAA
TCTTGGAGGTTTCCGGGTTCGCCAACGGCCAGTACATCACCAAAACCCTCTGA
 Primer design