SecReT4
Protein ID: 77993232
T4SS name [ID]Trb [71]
Gene symboltrbC
Locus tagpB8_015
StrainIncP-1beta multiresistance plasmid pB8
Repliconplasmid pB8 [GenBank: NC_007502] [Browse all T4SS(s) in this replicon]
Location [Strand]12613..13077 [+]
Productputative prepilin
Component typeTrbC
UniProt IDQ4LCF7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2e-18, Aligned region: 12..110
Protein Sequence: 154 a.a.     [Download]
>gi|77993232|ref|YP_358822.1| putative prepilin [uncultured bacterium]
MQATFPAFRLNRNALFYMGLFALLAFFLLAPQHAFASEGTGGSLPYESWLTNLRNSVTGPVAFALSIIGI
VVAGGILIFGGELNGFFRTLIFIVLVMALLVGAQNMMSTFFGRGAEIAALTDGALHQVKVAALDVAGFPG
EAVMRWAERGHIAG
 
Nucleotide Sequence: 465 bp     [Download]
>gi|77993219|ref|NC_007502.1|:12613-13077 Uncultured bacterium IncP-1beta multiresistance plasmid pB8
ATGCAAGCAACCTTCCCGGCATTCCGCCTCAACCGCAACGCCCTGTTCTACATGGGCCTCTTCGCCCTCC
TGGCGTTCTTCCTGCTGGCCCCCCAGCACGCATTCGCCTCCGAGGGCACCGGCGGCTCTCTGCCGTATGA
GAGCTGGCTGACCAACCTCCGCAACTCCGTCACCGGCCCGGTGGCCTTCGCGCTGTCGATCATCGGCATC
GTGGTCGCCGGCGGCATCCTCATCTTCGGCGGCGAACTCAACGGCTTCTTCCGCACGTTGATCTTCATCG
TCCTGGTCATGGCCCTGCTGGTCGGCGCGCAGAACATGATGAGCACGTTCTTCGGCCGTGGCGCGGAAAT
CGCCGCCCTGACCGATGGCGCGCTGCACCAGGTCAAGGTCGCCGCGCTGGACGTGGCCGGCTTCCCCGGC
GAAGCCGTCATGCGCTGGGCCGAGCGCGGCCACATCGCGGGGTAA
 Primer design