SecReT4
Protein ID: 77993234
T4SS name [ID]Trb [71]
Gene symboltrbE
Locus tagpB8_017
StrainIncP-1beta multiresistance plasmid pB8
Repliconplasmid pB8 [GenBank: NC_007502] [Browse all T4SS(s) in this replicon]
Location [Strand]13389..15947 [+]
ProductTrbE protein
Component typeTrbE
UniProt IDQ4LCF5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 1.7e-56, Aligned region: 218..431
AAA_10 [PF12846], Evalue: 2.9e-29, Aligned region: 489..770
Protein Sequence: 852 a.a.     [Download]
>gi|77993234|ref|YP_358824.1| TrbE protein [uncultured bacterium]
MIEAIAIAIAVLGAVLLLILFARIRAVDAELKLKKHRAKDAGLADLLNYAAAVDDGVIVGKNGSFMAAWL
YKGDDNASSTEEQREMVSFRINQALAGLGNGWMVHVDAVRRPAPNYSERGVSSFPDSVSFAIDEERRRLF
EGLGAMFEGYFVLTVTWFPPVLAQRKFVELMFDDDAVAPDHTARTTGLIAQFKREITSLESRLSSAVKMT
RLRGQKVVSEEGREVTHDDFLSWLQFCVTGLHHPVMLPSNPMYLDAVIGGQELWGGVVPKIGRKFIQVVA
IEGFPLESTPGVLSALAELPSEYRWSSRFIFMDQHESLKHLDKFRKKWKQKIRGFFDQVFNTNTGSINQD
AAAMVGDAEAAIAEVNSGLVAAGYYTSVVVLMDEDRERLAASALLVEKAVNRLAFAARIETINTLDAYLG
SLPGHGVENVRRPLINTMNLADLLPTSSIWTGSATAPCPMYPPLSPALMHCVTVGATPFRLNLHVRDLGH
TFMFGPTGAGKSTHLGIIAAQLRRYAGMSIYAFDKGMSMYPLAAGIRAATKGKSGLHFTVAADDDRLAFC
PLQFLETKGDRAWAMEWIDTILALNGVNTTPAQRNEIGNAIMSMHASGARTLSEFSVTIQDEAIREAIKQ
YTVDGSMGHLLDAEEDGLSLSDFTVFEIEELMNLGEKFALPVLLYLFRRIERALKGQPSVIILDEAWLML
GHPAFRAKIREWLKVLRKANCLVLMATQSLSDAANSGILDVIVESTATKIFLPNVYARDEDTSALYRRMG
LNARQIEILATAIPKRQYYYVSENGRRLYDLALGPMALAFVGASDKESVATIKSLEAKFGHEWVHEWLAG
RGLNLNDYLEAA
 
Nucleotide Sequence: 2559 bp     [Download]
>gi|77993219|ref|NC_007502.1|:13389-15947 Uncultured bacterium IncP-1beta multiresistance plasmid pB8
ATGATCGAAGCAATCGCAATTGCCATTGCTGTGCTCGGTGCGGTTCTGTTGCTCATCCTCTTTGCCCGCA
TCCGGGCTGTCGATGCCGAGCTGAAGCTCAAGAAGCATCGCGCCAAGGATGCCGGCCTGGCCGATCTGCT
CAATTACGCCGCCGCGGTCGATGACGGCGTGATCGTGGGCAAGAACGGCTCCTTTATGGCCGCCTGGCTG
TACAAGGGGGATGACAACGCCAGCAGCACCGAGGAACAGCGGGAAATGGTGTCGTTCCGCATCAACCAGG
CCCTGGCGGGCCTGGGGAACGGCTGGATGGTGCATGTCGATGCTGTGCGTCGGCCTGCGCCGAACTACTC
GGAGCGGGGCGTGTCATCGTTCCCCGACTCCGTTTCCTTCGCCATTGACGAGGAACGCCGGCGCTTGTTC
GAGGGCCTGGGCGCGATGTTCGAGGGCTACTTTGTCCTGACCGTCACGTGGTTCCCGCCAGTGCTGGCCC
AGCGCAAGTTTGTCGAACTCATGTTCGATGACGATGCGGTGGCTCCCGACCATACGGCGCGCACTACGGG
CCTGATTGCGCAGTTCAAGCGCGAGATCACCAGCCTGGAATCGCGCCTGTCCTCGGCGGTCAAGATGACG
CGCCTGCGCGGCCAAAAAGTCGTGTCGGAAGAGGGCAGGGAAGTCACGCACGATGACTTCCTGAGCTGGT
TGCAGTTCTGCGTGACGGGCCTCCATCACCCGGTCATGCTGCCCAGCAATCCGATGTACCTCGATGCGGT
AATCGGCGGGCAAGAGCTGTGGGGCGGCGTCGTGCCCAAGATCGGGCGCAAGTTCATCCAGGTGGTCGCC
ATCGAAGGCTTCCCCTTGGAGTCAACGCCTGGGGTGCTCTCGGCCCTGGCCGAGCTGCCCAGCGAATACC
GCTGGTCGAGCCGCTTCATCTTCATGGATCAGCACGAGTCCTTGAAGCACCTGGACAAGTTCCGCAAGAA
GTGGAAGCAGAAGATTCGCGGCTTCTTCGATCAGGTGTTCAACACGAATACCGGCTCGATCAACCAGGAC
GCGGCCGCGATGGTCGGCGACGCCGAGGCGGCCATCGCCGAGGTCAACAGCGGCTTGGTGGCGGCCGGCT
ACTACACCAGCGTGGTCGTGCTGATGGACGAGGATCGGGAGCGCCTGGCGGCCTCCGCGCTCCTGGTCGA
GAAGGCCGTCAACCGCCTGGCCTTCGCGGCCCGTATCGAGACGATCAACACGCTCGATGCGTACCTGGGC
AGCTTGCCCGGCCACGGCGTCGAGAACGTGCGCCGGCCGCTCATCAACACGATGAACCTGGCCGACCTGC
TGCCGACAAGCTCGATCTGGACGGGCAGCGCCACGGCTCCGTGCCCGATGTACCCGCCGCTGTCGCCGGC
GCTCATGCACTGCGTGACGGTGGGCGCTACGCCGTTCCGCCTGAACCTGCACGTGCGCGACCTGGGCCAC
ACCTTCATGTTCGGCCCGACCGGCGCAGGCAAATCGACGCACCTGGGCATCATCGCCGCGCAGCTCCGTC
GCTACGCCGGCATGTCGATCTACGCCTTCGACAAGGGCATGTCGATGTACCCACTCGCGGCCGGCATCCG
CGCGGCCACGAAGGGCAAGAGCGGCCTGCATTTCACGGTGGCCGCCGACGATGACCGCCTGGCGTTCTGC
CCGCTCCAGTTCCTCGAAACGAAGGGGGATAGGGCCTGGGCGATGGAGTGGATCGACACCATCCTGGCGT
TGAACGGCGTCAACACCACGCCGGCGCAGCGCAACGAGATCGGCAACGCGATCATGAGCATGCACGCCAG
CGGCGCGCGCACGCTCTCCGAGTTCTCGGTGACGATTCAGGACGAGGCGATCCGCGAGGCCATCAAGCAG
TACACGGTGGACGGCTCGATGGGCCACCTGCTCGACGCCGAAGAGGACGGCCTGTCGCTGTCCGACTTCA
CGGTGTTCGAGATCGAAGAGCTGATGAACCTGGGCGAGAAGTTCGCGCTGCCGGTGCTGCTCTACCTGTT
CCGCCGCATCGAGCGCGCACTGAAAGGCCAGCCCTCCGTCATCATCCTGGACGAAGCCTGGTTGATGCTG
GGCCACCCCGCGTTCCGCGCCAAGATCAGGGAATGGCTCAAGGTGCTGCGCAAGGCCAACTGCCTTGTGC
TGATGGCGACGCAAAGCCTCTCCGACGCGGCCAACTCGGGCATCTTGGACGTGATCGTGGAATCGACCGC
GACCAAGATTTTCCTGCCCAACGTCTACGCCAGGGATGAGGACACATCGGCGCTCTATCGCCGTATGGGC
CTCAACGCGCGTCAGATCGAAATCCTGGCGACTGCCATTCCGAAGCGTCAGTACTACTACGTCTCGGAGA
ACGGCCGCCGTCTCTATGACCTTGCCCTGGGGCCGATGGCCCTGGCCTTCGTCGGTGCGTCCGACAAGGA
ATCGGTCGCCACCATCAAGAGCCTCGAAGCCAAGTTCGGCCACGAATGGGTGCATGAGTGGCTGGCCGGC
CGTGGGCTGAATCTCAACGACTACCTGGAGGCCGCATGA
 Primer design