SecReT4
Protein ID: 77993235
T4SS name [ID]Trb [71]
Gene symboltrbF
Locus tagpB8_018
StrainIncP-1beta multiresistance plasmid pB8
Repliconplasmid pB8 [GenBank: NC_007502] [Browse all T4SS(s) in this replicon]
Location [Strand]15944..16726 [+]
ProductTrbF protein
Component typeTrbF
UniProt IDQ4LCF4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.3e-58, Aligned region: 46..258
Protein Sequence: 260 a.a.     [Download]
>gi|77993235|ref|YP_358825.1| TrbF protein [uncultured bacterium]
MSIADTLKGLIFKKPANSAEPRDPRRSKEPLAGGRRAGEAENPYLAARRTWNDHVGGVVSQRQTWQVIGI
LSLLIALAGVGGVIHIGSQSKFIPYVVEVDKLGQTVAAGPVQAAGKADPRVIHAAVADWMSCARMVSPDV
ALQRKCVFKAYSMLAPNDPATPKMNEWLNGTPDSSPFKRAEKEMVSVEIKTVIPQTPDTWQVEWVETTRD
RQGTLKGQPVTWRALVTTYIAEVTPNTTDEQLRNNPLSIYVRDYSWSRIQ
 
Nucleotide Sequence: 783 bp     [Download]
>gi|77993219|ref|NC_007502.1|:15944-16726 Uncultured bacterium IncP-1beta multiresistance plasmid pB8
ATGAGCATCGCCGACACCCTCAAGGGCTTGATCTTCAAGAAGCCCGCCAACTCCGCCGAGCCGCGCGATC
CGCGCCGCTCGAAGGAACCGCTCGCCGGCGGCCGCCGTGCGGGCGAGGCCGAGAACCCCTACCTGGCCGC
GCGCCGCACCTGGAACGATCACGTGGGCGGCGTCGTCTCGCAGCGCCAAACCTGGCAGGTGATCGGCATC
CTGTCGCTGTTGATCGCGCTGGCCGGCGTGGGTGGCGTGATCCACATCGGCAGCCAGTCGAAGTTCATCC
CCTACGTGGTCGAGGTGGACAAGCTGGGCCAGACGGTGGCCGCCGGCCCGGTGCAGGCCGCAGGGAAGGC
CGATCCGCGTGTCATCCACGCCGCCGTTGCGGACTGGATGAGCTGCGCGCGCATGGTGTCGCCTGACGTG
GCCTTGCAGCGCAAGTGCGTGTTCAAGGCGTACTCGATGCTCGCCCCCAACGATCCGGCGACGCCAAAGA
TGAACGAGTGGTTGAACGGCACGCCCGATTCCAGCCCGTTCAAGCGCGCCGAGAAGGAAATGGTCAGCGT
CGAGATCAAGACCGTCATCCCGCAAACGCCCGACACCTGGCAAGTCGAGTGGGTGGAAACCACGCGCGAC
CGCCAAGGCACGCTGAAAGGTCAGCCCGTCACCTGGCGCGCGCTCGTGACTACCTACATCGCCGAGGTCA
CGCCCAACACCACCGATGAGCAACTGCGGAACAACCCGTTGAGCATCTACGTGCGTGATTACTCCTGGTC
CCGCATCCAATGA
 Primer design