SecReT4
Protein ID: 77993237
T4SS name [ID]Trb [71]
Gene symboltrbH
Locus tagpB8_020
StrainIncP-1beta multiresistance plasmid pB8
Repliconplasmid pB8 [GenBank: NC_007502] [Browse all T4SS(s) in this replicon]
Location [Strand]17646..18134 [+]
ProductTrbH protein
Component typeTrbH
UniProt IDQ4LCF2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbH [PF07283], Evalue: 7.1e-49, Aligned region: 33..162
Protein Sequence: 162 a.a.     [Download]
>gi|77993237|ref|YP_358827.1| TrbH protein [uncultured bacterium]
MRKIVSLALLALALGLGGCATTSQYGNFVQSAALDQQKLATDAVQQLATLYAPARTRLELQQPTPDPFGQ
ALVKSLRDKGYALLEYAPAGASTQAPASAASQASAPATTAASGGLPLRYVLDQAGDSNLYRLTLMVGNQS
ITRPYLAQNGTFAPAGYWVRKE
 
Nucleotide Sequence: 489 bp     [Download]
>gi|77993219|ref|NC_007502.1|:17646-18134 Uncultured bacterium IncP-1beta multiresistance plasmid pB8
ATGCGCAAGATCGTCTCTCTCGCGCTGCTCGCCCTCGCCCTGGGCCTCGGCGGCTGCGCAACCACCAGCC
AGTACGGCAACTTCGTCCAGTCGGCCGCGCTCGATCAGCAGAAGCTCGCCACCGACGCGGTGCAGCAGCT
CGCCACGCTGTACGCGCCGGCGCGCACGCGCCTGGAGCTGCAACAGCCGACGCCCGATCCGTTCGGCCAG
GCGCTCGTCAAGTCGCTGCGCGACAAGGGCTATGCCCTCCTGGAGTACGCCCCGGCCGGCGCTTCCACGC
AGGCCCCGGCCTCGGCGGCATCGCAGGCGAGCGCACCGGCCACCACGGCCGCGTCGGGCGGCCTGCCGTT
GCGCTACGTGCTCGACCAGGCTGGCGACTCGAACCTGTACCGCCTGACCTTGATGGTCGGCAATCAATCC
ATCACCCGCCCTTACCTGGCGCAAAACGGCACGTTCGCGCCGGCCGGGTACTGGGTGCGCAAGGAGTGA
 Primer design