SecReT4
Protein ID: 77993238
T4SS name [ID]Trb [71]
Gene symboltrbI
Locus tagpB8_021
StrainIncP-1beta multiresistance plasmid pB8
Repliconplasmid pB8 [GenBank: NC_007502] [Browse all T4SS(s) in this replicon]
Location [Strand]18139..19560 [+]
ProductTrbI protein
Component typeTrbI
UniProt IDQ4LCF1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.3e-65, Aligned region: 279..464
Protein Sequence: 473 a.a.     [Download]
>gi|77993238|ref|YP_358828.1| TrbI protein [uncultured bacterium]
MTENADQMAPDASPGEVSKKAGVRRVNNMPMYILGGVLLSFVLVMALVAADRAAKQNAPADGPKEKAGNT
SMFAKEIAGDKTGGLIEPASPLKVPDMPTGPASAPLEIARPSNPDAPPAPPANPGNPGQPVNDDEAQRIR
MAKMQMFGEAVKAKTTVRVDAPRSNGSAPGGPSTYTGTPQTRDEMLNRIAAVQQQIDAQRSNDPTAAYQA
RLAQIRGMGVGGGGAAPAAGGMGAGGAPQLLQTSTSGGGRNSMAQFGQGGQGDRWKLDSQPEAPRTPFEL
RAGFVVPATLISGINSDLPGQIMAQVAQDVYDTPTGKHLLIPQGSRLVGSYSSDVAYGQARVLVAWQRIV
FPDGKAMDIGAMPGADSAGYAGFHDQVNNHYVRLFGSAFLMSGVTAGITYSQRQNQATNTYGAPSASSAL
SEALGQQLGQVTAQLIAKNLSISPTLEIRPGYRFNVVVTKDMTFSKPYRSFDY
 
Nucleotide Sequence: 1422 bp     [Download]
>gi|77993219|ref|NC_007502.1|:18139-19560 Uncultured bacterium IncP-1beta multiresistance plasmid pB8
ATGACAGAAAACGCCGATCAGATGGCACCTGACGCTTCGCCTGGCGAAGTGTCCAAGAAGGCGGGCGTCC
GTCGCGTCAACAACATGCCCATGTACATCCTCGGCGGCGTCCTGCTGTCGTTCGTGCTGGTCATGGCCCT
GGTCGCGGCGGATCGCGCGGCCAAGCAGAACGCGCCGGCGGACGGCCCCAAGGAGAAGGCCGGCAACACG
TCGATGTTCGCCAAGGAGATCGCAGGCGACAAGACCGGCGGCTTGATCGAGCCGGCAAGCCCGCTCAAGG
TGCCCGACATGCCGACCGGCCCGGCGTCGGCTCCGCTGGAGATCGCGCGGCCGTCCAACCCGGACGCGCC
GCCGGCCCCGCCGGCCAACCCCGGCAACCCGGGCCAGCCGGTGAACGACGACGAGGCCCAGCGCATCCGC
ATGGCGAAGATGCAGATGTTCGGCGAAGCCGTGAAGGCCAAGACCACCGTGCGCGTGGATGCCCCGCGTA
GCAACGGCTCCGCGCCGGGTGGCCCGAGCACCTACACCGGCACGCCGCAGACGCGCGATGAAATGCTGAA
CCGCATCGCAGCGGTGCAGCAGCAAATTGACGCGCAGCGCAGCAACGATCCGACCGCCGCCTATCAAGCA
CGCCTGGCGCAGATTCGCGGCATGGGCGTCGGTGGTGGCGGCGCGGCTCCGGCCGCCGGCGGCATGGGCG
CGGGCGGTGCGCCGCAGCTCCTGCAAACCTCGACCAGCGGCGGCGGGCGCAACAGCATGGCGCAGTTCGG
CCAAGGTGGGCAGGGCGACCGCTGGAAGCTGGATTCGCAGCCGGAAGCGCCGCGCACACCGTTCGAGCTG
CGCGCGGGCTTCGTCGTGCCGGCCACGCTCATTTCGGGCATCAACTCCGATCTGCCGGGCCAAATCATGG
CCCAGGTCGCGCAGGACGTGTACGACACACCGACCGGCAAGCACCTGTTGATCCCGCAGGGATCGCGCCT
CGTCGGCTCGTATTCGAGCGACGTGGCCTACGGCCAAGCGCGCGTGCTGGTTGCGTGGCAACGCATCGTG
TTCCCCGATGGCAAGGCGATGGACATTGGCGCGATGCCAGGCGCGGACAGCGCGGGATACGCGGGCTTCC
ACGACCAGGTGAACAACCACTATGTGCGCCTGTTCGGCTCGGCCTTCCTCATGTCCGGCGTGACAGCAGG
CATCACCTACAGCCAACGCCAGAACCAGGCCACAAACACCTATGGCGCACCGAGCGCCAGCAGTGCCCTA
AGCGAAGCCCTCGGCCAGCAGCTCGGCCAGGTTACGGCGCAACTCATCGCCAAGAACCTGAGCATTTCGC
CGACGCTGGAAATTCGGCCGGGGTATCGCTTCAACGTCGTGGTCACGAAGGACATGACGTTTTCCAAGCC
GTACCGTTCCTTCGATTACTAA
 Primer design