SecReT4
Protein ID: 77993239
T4SS name [ID]Trb [71]
Gene symboltrbJ
Locus tagpB8_022
StrainIncP-1beta multiresistance plasmid pB8
Repliconplasmid pB8 [GenBank: NC_007502] [Browse all T4SS(s) in this replicon]
Location [Strand]19581..20345 [+]
ProductTrbJ protein
Component typeTrbJ
UniProt IDQ4LCF0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 254 a.a.     [Download]
>gi|77993239|ref|YP_358829.1| TrbJ protein [uncultured bacterium]
MKPKFLAAKLALVIAVSSTLAVTPVQAGIPVIDGTNLSQNIMTAIESVAQTLKQIEQYSTQLQQYQNQLQ
NTMAPAAYIWDQAQSTINGLMNAVNTLDYYKTQLGSLDSYIGKFQDVNYYKNSPCFTAAGCSDAERAALR
NVAQLASESQKKANDALFKGLDRQQTNLTADAATLQRLQSAAQGAQGQMQAIGYANQLASQQANQLLQIR
GLLIAQQNAMATKMQADADKEAQQAAAAAQLRQGSYRASPARTW
 
Nucleotide Sequence: 765 bp     [Download]
>gi|77993219|ref|NC_007502.1|:19581-20345 Uncultured bacterium IncP-1beta multiresistance plasmid pB8
ATGAAGCCGAAGTTTTTAGCCGCTAAATTGGCCCTCGTCATTGCTGTTTCGAGCACGCTGGCGGTCACAC
CTGTGCAGGCTGGCATCCCCGTCATCGACGGCACCAACCTGTCGCAGAACATCATGACGGCCATCGAATC
GGTGGCCCAAACGCTCAAGCAAATTGAGCAGTACAGCACCCAGCTCCAGCAGTATCAGAACCAGCTCCAG
AACACGATGGCCCCGGCCGCGTATATCTGGGATCAGGCGCAATCGACCATCAACGGGTTGATGAACGCGG
TCAACACGCTGGATTACTACAAGACCCAACTCGGCAGCCTGGACAGCTACATCGGCAAGTTCCAGGACGT
GAACTACTACAAGAACTCGCCGTGCTTTACGGCGGCAGGGTGCTCCGACGCGGAACGCGCAGCACTTCGG
AATGTGGCCCAGCTCGCGAGCGAGTCGCAGAAGAAGGCCAACGATGCCTTGTTCAAGGGCCTCGATAGGC
AGCAAACGAATCTCACGGCCGATGCAGCGACGTTGCAGCGTCTTCAATCGGCAGCGCAGGGCGCGCAGGG
CCAAATGCAGGCCATCGGCTACGCCAACCAGCTCGCCAGCCAGCAGGCCAACCAGCTCTTGCAGATTCGT
GGCCTGCTGATCGCGCAGCAGAACGCGATGGCAACCAAGATGCAGGCCGACGCCGACAAGGAAGCCCAGC
AGGCGGCAGCGGCCGCACAACTGCGCCAGGGCAGCTACCGGGCCAGCCCGGCGCGCACCTGGTAA
 Primer design