SecReT4
Protein ID: 77993240
T4SS name [ID]Trb [71]
Gene symboltrbK
Locus tagpB8_023
StrainIncP-1beta multiresistance plasmid pB8
Repliconplasmid pB8 [GenBank: NC_007502] [Browse all T4SS(s) in this replicon]
Location [Strand]20355..20582 [+]
ProductTrbK protein
Component typeTrbK
UniProt IDQ4LCE9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 75 a.a.     [Download]
>gi|77993240|ref|YP_358830.1| TrbK protein [uncultured bacterium]
MKAIKALSLASAALVAALVAGCDNKPATAPMPEVNDENCKPENIAKIEDKGVQQAFSSLCLRRGGDFKPS
PKREW
 
Nucleotide Sequence: 228 bp     [Download]
>gi|77993219|ref|NC_007502.1|:20355-20582 Uncultured bacterium IncP-1beta multiresistance plasmid pB8
ATGAAAGCAATCAAGGCTCTGTCCTTGGCCTCGGCCGCCCTCGTGGCGGCCTTGGTCGCCGGCTGCGACA
ACAAGCCGGCCACGGCCCCCATGCCGGAAGTGAACGACGAGAACTGCAAGCCCGAGAACATCGCCAAGAT
CGAGGACAAGGGCGTCCAGCAGGCTTTTTCGTCGCTGTGCTTGCGTCGTGGTGGGGATTTCAAGCCCAGC
CCGAAACGCGAATGGTGA
 Primer design