SecReT4
Protein ID: 77993241
T4SS name [ID]Trb [71]
Gene symboltrbL
Locus tagpB8_024
StrainIncP-1beta multiresistance plasmid pB8
Repliconplasmid pB8 [GenBank: NC_007502] [Browse all T4SS(s) in this replicon]
Location [Strand]20593..22311 [+]
ProductTrbL protein
Component typeTrbL
UniProt IDQ4LCE8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.6e-38, Aligned region: 65..279
Protein Sequence: 572 a.a.     [Download]
>gi|77993241|ref|YP_358831.1| TrbL protein [uncultured bacterium]
MRMPANLKTLALPLFVWLAFFAVDAHAAIDNAGVFDSVLDRYQAAASGWAGVITTAATWLFWTLVVISMV
WTFGMMALRKADIGEFFAEFVRFTIFTGFFWWALTNGPNFASSIYASLRQLAGNATGLGNALSPSGIVDV
GFAIFDKVMDQSSVWSPVDSMAGILMAVAILVILALVGVNMLLLLASGWVLAYGGVFFLGFGGSRWTSDM
AINYYKVVLGVAAQLFAMVLLVGIGKTFLDDYYSRMSAGISLKEMGVMLIVVIILLALVNKIPPLIAGII
TGASVGGAGIGQFGAGAALGAAGMAAAAAATGGAALAAGAASAAGGASAVMAAFSKANENVSAGTDVMSA
FSGGGSSGGGAGGGGDAGTGSTPFAQAAGFSGSSGGGSSSGGGSPSTGSSSGSSKGGDKGGGKADAGGQG
SSSTASTGSSADKAAKNEPKPAGGAGQGQQAAPGSTGPGLLASAASALGTAGRIAADAGANLAKGTADVA
KAKAASLREAAAERIADTTGGKIAAAIKAQGSGTAENIDVPDQQPAPSFGDNSLAGGPADADPESEVAAF
ANREQGRDGTTA
 
Nucleotide Sequence: 1719 bp     [Download]
>gi|77993219|ref|NC_007502.1|:20593-22311 Uncultured bacterium IncP-1beta multiresistance plasmid pB8
ATGAGAATGCCAGCCAATCTAAAAACCCTCGCCCTGCCGCTGTTCGTCTGGCTGGCGTTCTTCGCGGTCG
ATGCCCACGCGGCCATCGACAACGCCGGCGTGTTCGATAGCGTGCTGGATCGCTACCAGGCCGCCGCGAG
CGGCTGGGCCGGTGTCATCACCACGGCCGCAACCTGGCTCTTCTGGACGCTGGTTGTGATCTCGATGGTC
TGGACGTTCGGCATGATGGCCTTGCGCAAGGCCGACATTGGCGAGTTCTTCGCGGAGTTCGTCCGCTTCA
CGATCTTTACCGGCTTCTTCTGGTGGGCGCTGACCAACGGCCCTAACTTCGCCTCGTCCATCTATGCGTC
GTTGCGGCAGCTCGCCGGCAACGCGACGGGCCTGGGCAATGCTCTGTCGCCCTCGGGCATCGTGGACGTG
GGCTTTGCGATCTTCGACAAGGTGATGGATCAGTCCTCGGTGTGGTCGCCGGTGGACAGCATGGCCGGCA
TCCTCATGGCCGTGGCGATCCTGGTCATCCTGGCCCTGGTCGGTGTGAATATGCTTCTGCTGCTCGCGTC
GGGCTGGGTGCTCGCCTACGGCGGCGTGTTCTTCCTCGGCTTCGGTGGTTCGCGCTGGACTTCCGACATG
GCGATCAACTACTACAAGGTCGTCCTGGGCGTGGCCGCGCAGCTCTTCGCAATGGTGCTCCTGGTGGGCA
TCGGCAAGACCTTCCTCGATGACTACTACTCGCGCATGAGCGCCGGCATCAGCCTCAAGGAAATGGGCGT
GATGCTGATCGTCGTCATCATCCTCTTGGCGTTGGTCAACAAGATTCCGCCGCTCATCGCCGGGATCATC
ACCGGCGCGAGCGTGGGCGGTGCCGGCATCGGCCAGTTCGGTGCAGGCGCTGCGTTGGGTGCCGCAGGCA
TGGCAGCAGCAGCGGCCGCGACCGGCGGCGCCGCTCTGGCCGCCGGCGCAGCCTCGGCCGCCGGTGGTGC
CTCTGCCGTCATGGCCGCCTTCTCGAAGGCCAATGAGAACGTGTCGGCAGGCACGGACGTTATGTCGGCC
TTCTCGGGCGGCGGCAGCTCGGGCGGCGGTGCGGGCGGCGGCGGCGACGCCGGCACCGGCAGCACGCCCT
TCGCTCAGGCTGCGGGCTTTAGCGGCAGCTCCGGCGGTGGCTCTTCGTCGGGTGGCGGCAGCCCCTCGAC
CGGCAGCAGCTCGGGCAGCTCGAAGGGCGGCGATAAGGGCGGCGGCAAAGCCGACGCCGGCGGCCAGGGC
AGCAGCTCGACGGCCAGCACCGGCAGCAGTGCCGACAAGGCCGCCAAGAACGAACCCAAGCCCGCCGGCG
GGGCAGGGCAAGGGCAGCAGGCCGCACCGGGCAGCACCGGCCCCGGCTTGCTCGCATCGGCCGCATCGGC
CCTCGGCACGGCCGGCCGCATCGCCGCCGACGCCGGCGCGAACTTGGCGAAGGGAACCGCCGATGTTGCC
AAGGCCAAAGCCGCGAGCCTGCGCGAAGCCGCAGCCGAGCGGATCGCCGACACCACTGGCGGAAAGATCG
CCGCCGCGATCAAGGCGCAAGGAAGCGGCACGGCCGAGAACATCGACGTGCCCGACCAGCAGCCCGCGCC
GAGCTTCGGCGACAACAGCCTGGCAGGCGGCCCCGCCGATGCCGATCCCGAGTCCGAAGTAGCTGCGTTC
GCCAACCGCGAGCAAGGCCGCGACGGCACAACTGCGTAA
 Primer design