SecReT4
Protein ID: 77993243
T4SS name [ID]Trb [71]
Gene symboltrbN
Locus tagpB8_026
StrainIncP-1beta multiresistance plasmid pB8
Repliconplasmid pB8 [GenBank: NC_007502] [Browse all T4SS(s) in this replicon]
Location [Strand]22930..23565 [+]
Productputative muramidase
Component typeTrbN
UniProt IDQ4LCE6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 211 a.a.     [Download]
>gi|77993243|ref|YP_358833.1| putative muramidase [uncultured bacterium]
MPFFADLPPQLQERVVCSISAAVKYEVPVNIVLAVAEKEGGKPGQWVRNSNGTHDVGPMQFNTAYLGDLA
RYGITANDVAAAGCYSFDLAAWRLRMHIRNDKGDLWTKAANYHSRTPQYNAVYRADLMRKASKWADWLEA
RFVTLDVTKAGATPSTPSQPATVAQRATPAARPAPAPQQAAPAAAAARSVSVAGYVPRTVSFNTSREGSA
E
 
Nucleotide Sequence: 636 bp     [Download]
>gi|77993219|ref|NC_007502.1|:22930-23565 Uncultured bacterium IncP-1beta multiresistance plasmid pB8
ATGCCGTTCTTCGCCGATCTGCCGCCGCAGCTCCAGGAGCGCGTCGTCTGCTCGATCTCGGCCGCCGTCA
AGTACGAGGTGCCGGTCAACATCGTGTTGGCCGTCGCCGAGAAAGAGGGCGGCAAGCCGGGCCAGTGGGT
GCGCAACTCGAATGGCACGCATGACGTTGGCCCGATGCAGTTCAACACCGCGTACCTGGGCGACCTGGCC
CGATACGGCATCACGGCGAACGATGTGGCGGCTGCCGGCTGCTACTCGTTCGACCTGGCCGCCTGGCGGC
TGCGGATGCACATCCGCAACGACAAGGGCGACCTCTGGACGAAGGCGGCGAACTACCACTCGCGCACGCC
GCAGTACAACGCGGTGTACCGGGCCGACTTGATGCGCAAGGCGTCGAAGTGGGCCGATTGGCTCGAAGCT
CGGTTCGTCACGCTTGACGTGACGAAGGCCGGGGCCACGCCCTCGACGCCCAGCCAGCCCGCGACGGTGG
CCCAGCGGGCGACGCCGGCGGCCAGGCCGGCACCAGCACCCCAGCAGGCCGCCCCAGCGGCCGCAGCAGC
TCGCAGCGTGTCGGTGGCCGGCTACGTGCCCCGCACGGTGTCTTTCAACACTTCACGCGAGGGGTCGGCC
GAGTAG
 Primer design