SecReT4
Protein ID: 77993259
T4SS name [ID]Trb [71]
Gene symboltraF
Locus tagpB8_042
StrainIncP-1beta multiresistance plasmid pB8
Repliconplasmid pB8 [GenBank: NC_007502] [Browse all T4SS(s) in this replicon]
Location [Strand]40948..41484 [-]
Productpossible protease
Component typeTraF
UniProt IDQ4LCD0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 1.7e-45, Aligned region: 32..177
Protein Sequence: 178 a.a.     [Download]
>gi|77993259|ref|YP_358849.1| possible protease [uncultured bacterium]
MSRILKRIAAGVVIAGVAALLLAAGGYAAGARVNTTKSIPVGLYWTSSAPVEKGAYVLFCPPQLGVFDDA
KERGYIGAGFCQGGYGYMMKRVLAAKDDAVAVADDGVRVNGELLPLSAPIKADKAGRPLPRYQSNSYTLG
NSEVLLMSDVSATSFDGRYFGPINRSQIKTVIRPVITW
 
Nucleotide Sequence: 537 bp     [Download]
>gi|77993219|ref|NC_007502.1|:c41484-40948 Uncultured bacterium IncP-1beta multiresistance plasmid pB8
ATGAGCCGCATCCTGAAACGTATCGCGGCAGGCGTCGTCATCGCGGGCGTGGCCGCCCTGCTGCTGGCCG
CCGGCGGCTATGCCGCCGGTGCCCGCGTGAACACCACCAAGAGCATTCCGGTCGGCCTGTACTGGACGAG
CAGCGCGCCGGTGGAGAAGGGGGCCTACGTCCTCTTCTGCCCGCCGCAGCTCGGCGTGTTCGATGACGCC
AAGGAGAGGGGCTACATCGGGGCCGGCTTCTGCCAGGGCGGCTACGGCTACATGATGAAGCGCGTTTTAG
CCGCTAAAGACGATGCCGTCGCCGTCGCCGATGACGGCGTGCGCGTCAACGGCGAGCTGCTGCCCCTCAG
CGCGCCGATCAAGGCCGACAAGGCCGGTCGGCCGCTGCCGCGCTATCAGTCCAACAGCTACACGCTCGGC
AATTCCGAGGTGCTGCTTATGTCGGACGTGAGCGCCACATCCTTCGACGGCCGCTACTTCGGCCCGATCA
ATCGTTCGCAAATCAAGACCGTGATCCGTCCGGTCATCACCTGGTAG
 Primer design