SecReT4
Protein ID: 77993260
T4SS name [ID]Trb [71]
Gene symboltraG
Locus tagpB8_043
StrainIncP-1beta multiresistance plasmid pB8
Repliconplasmid pB8 [GenBank: NC_007502] [Browse all T4SS(s) in this replicon]
Location [Strand]41481..43394 [-]
ProductTraG protein
Component typeTraG
UniProt IDQ4LCC9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.8e-162, Aligned region: 121..620
TraG-D_C [PF12696], Evalue: 1.9e-32, Aligned region: 444..568
TrwB_AAD_bind [PF10412], Evalue: 1.5e-26, Aligned region: 177..568
Protein Sequence: 637 a.a.     [Download]
>gi|77993260|ref|YP_358850.1| TraG protein [uncultured bacterium]
MKIKMNNAVGPQVRTAKPKPSKLLPVLGAASMVGGLQAATQFFAHTFAYHATLGPNVGHVYAPWSILHWT
YKWYSQYPDEIMKAGSMGMLVSTVGLLGVAVAKVVTSNSSKANEYLHGSARWAEKKDIQAAGLLPRERNV
LEIVTGKAAPTATGVYVGGWQDKDGNFFYLRHSGPEHVLTYAPTRSGKGVGLVVPTLLSWGASSVITDLK
GELWALTAGWRQKHAKNKVLRFEPASTSGGVCWNPLDEIRLGTEYEVGDVQNLATLIVDPDGKGLDSHWQ
KTAFALLVGVILHALYKAKDDGGTATLPSVDAMLADPNRDIGELWMEMATYGHVDGQNHHAIGSAARDMM
DRPEEEAGSVLSTAKSYLALYRDPVVARNVSRSDFRIKQLMHEDDPVSLYIVTQPNDKARLRPLVRVMVN
MIVRLLADKMDFEGGRPVAHYKHRLLMMLDEFPSLGKLEIMQESLAFVAGYGIKCYLICQDINQLKSRET
GYGHDESITSNCHVQNAYPPNRVETAEHLSRLTGQTTVVKEQITTSGRRTAAMLGQVSRTYQEVQRPLLT
PDECLRMPGPKKNAQGEIEEAGDMVIYVAGYPAIYGKQPLYFKDPVFSARAAIPAPKVSDRLRAVAQAET
EGEGITI
 
Nucleotide Sequence: 1914 bp     [Download]
>gi|77993219|ref|NC_007502.1|:c43394-41481 Uncultured bacterium IncP-1beta multiresistance plasmid pB8
ATGAAGATCAAGATGAACAACGCGGTAGGGCCGCAAGTCCGAACCGCCAAACCGAAGCCGAGCAAGCTGC
TGCCGGTGCTGGGCGCGGCCTCGATGGTCGGCGGCCTCCAGGCCGCGACGCAGTTCTTCGCCCACACGTT
CGCCTATCACGCGACCCTCGGCCCCAACGTGGGCCACGTGTACGCGCCCTGGTCGATCCTGCACTGGACG
TACAAGTGGTACAGCCAGTACCCGGACGAGATCATGAAGGCCGGCAGCATGGGGATGCTGGTTTCGACCG
TGGGCCTGCTGGGCGTGGCCGTGGCGAAGGTCGTCACGTCCAACAGCTCGAAGGCGAACGAGTACCTGCA
CGGCTCGGCCCGCTGGGCCGAGAAGAAGGACATTCAGGCGGCCGGCCTGCTGCCACGCGAGCGCAACGTC
CTGGAGATCGTCACCGGCAAGGCCGCACCCACGGCTACCGGCGTGTACGTGGGCGGCTGGCAGGACAAGG
ACGGCAATTTCTTCTACCTGCGGCACAGCGGCCCCGAGCACGTGCTGACCTACGCGCCCACGCGCTCGGG
CAAGGGCGTCGGCCTGGTGGTGCCCACGCTGCTGTCGTGGGGCGCGAGCAGCGTCATCACCGACTTGAAG
GGCGAGTTGTGGGCCTTGACCGCCGGCTGGCGGCAGAAGCACGCCAAGAACAAGGTGCTGCGCTTCGAGC
CGGCCAGCACCTCGGGCGGCGTCTGCTGGAATCCGCTGGACGAAATCCGCCTCGGCACCGAATACGAGGT
GGGTGACGTGCAGAACCTTGCCACGCTGATCGTTGACCCGGACGGCAAGGGCCTGGACTCGCACTGGCAG
AAGACCGCCTTCGCGCTCCTGGTCGGCGTGATCCTGCACGCGCTGTACAAGGCCAAGGACGATGGCGGCA
CCGCCACGCTGCCGTCCGTCGATGCGATGCTGGCCGACCCGAACCGGGACATTGGCGAGCTTTGGATGGA
AATGGCGACCTACGGGCACGTAGACGGCCAGAACCATCACGCCATCGGCTCGGCGGCCCGCGACATGATG
GATCGGCCCGAGGAAGAAGCCGGATCGGTGCTGTCCACGGCCAAGTCGTACCTGGCCCTGTACCGCGACC
CCGTGGTGGCCCGCAACGTCAGCCGGTCGGACTTCCGCATCAAGCAGTTGATGCACGAGGACGACCCGGT
AAGCCTCTACATCGTCACCCAGCCCAACGATAAGGCCCGCCTGCGGCCGCTGGTGCGCGTCATGGTGAAC
ATGATCGTGCGCCTGCTGGCCGACAAGATGGACTTCGAGGGCGGCCGGCCGGTGGCGCACTACAAGCACC
GGCTCTTGATGATGCTGGACGAGTTCCCGAGCCTCGGGAAGCTGGAGATCATGCAAGAGTCGCTGGCCTT
CGTGGCCGGCTACGGCATCAAGTGCTACCTCATCTGCCAGGACATTAACCAGCTCAAGAGCCGCGAGACG
GGCTACGGCCACGACGAAAGCATCACGTCGAACTGCCACGTGCAGAACGCCTACCCGCCCAACCGCGTCG
AGACGGCCGAACACCTGTCCCGCCTCACCGGGCAGACCACCGTGGTGAAGGAGCAGATCACGACCAGCGG
CCGCCGCACGGCGGCGATGCTGGGCCAGGTGTCGCGCACTTACCAGGAAGTGCAGCGGCCCTTGCTGACG
CCCGACGAATGCCTGCGCATGCCGGGGCCAAAGAAGAACGCCCAGGGCGAGATCGAAGAAGCCGGCGACA
TGGTGATCTACGTCGCGGGCTACCCGGCGATCTACGGCAAGCAACCCCTGTACTTCAAAGACCCAGTGTT
CTCGGCACGCGCCGCGATCCCTGCGCCCAAGGTCAGCGACCGCCTGCGCGCCGTCGCACAGGCCGAGACG
GAAGGGGAGGGCATCACGATATGA
 Primer design