SecReT4
Protein ID: 78045294
T4SS name [ID]VirB [633]
Gene symbolvirB11
Locus tagXCVc0029
StrainXanthomonas campestris pv. vesicatoria str. 85-10
Repliconplasmid pXCV38 [GenBank: NC_007506] [Browse all T4SS(s) in this replicon]
Location [Strand]22881..23903 [-]
Producttype IV secretion system protein VirB11
Component typeVirB11
UniProt IDQ3C0D4
KEGG IDxcv:XCVc0029
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 3.4e-68, Aligned region: 13..323
Protein Sequence: 340 a.a.     [Download]
>gi|78045294|ref|YP_361545.1| type IV secretion system protein VirB11 [Xanthomonas campestris pv. vesicatoria str. 85-10]
MSQIASFRTKLSLLADHLDDKQVTEIQVNKPGELWLRKKDAYYAEQIEVPGLTYQLLSSLAEVTASFKSL
DVDRESPILSAEIPVNLDDGVPDFERGTYRTEMILPPVVPEGTIAMTIRKQSLVRMSLPKYKEQGAFRFV
NSDVTDEPYSDARLLELYRAKEWDQFLRGAVLAHKNIVISAGTYCGKTTCLNALVQEIPAHERIVTIEDS
REIEPAQPNCVRLSYARHQASGQAAVTPTTLLRSCMRLTPDRVIMGEIRGPEAVEFLNMLNTGHKGSLTT
IHTDSPAEMYDRFGELMDGHTSMTREQVIARVKRRIDVVVQWKYTERNGRYISEIIYAGA
 
Nucleotide Sequence: 1023 bp     [Download]
>gi|78045265|ref|NC_007506.1|:c23903-22881 Xanthomonas campestris pv. vesicatoria str. 85-10 plasmid pXCV38, complete sequence
ATGTCGCAGATTGCCTCCTTCCGTACCAAGCTCTCCTTGCTGGCCGACCATCTCGATGACAAGCAGGTCA
CCGAGATTCAGGTCAACAAGCCGGGAGAGCTGTGGCTGCGAAAGAAAGACGCGTACTACGCCGAGCAAAT
TGAAGTGCCGGGGCTGACATACCAGTTGCTTTCGTCACTGGCCGAGGTCACGGCGTCTTTCAAGAGTCTG
GACGTTGATCGGGAGAGTCCGATCCTCTCGGCGGAGATTCCGGTGAATCTCGATGACGGCGTTCCAGACT
TCGAGCGCGGAACGTACCGCACTGAAATGATCCTTCCGCCTGTCGTACCGGAGGGCACCATCGCGATGAC
GATTCGTAAGCAATCGCTGGTTCGCATGAGCCTGCCGAAATACAAGGAGCAGGGCGCTTTCCGATTCGTC
AATAGCGACGTGACCGATGAGCCGTATTCCGATGCTCGCTTGCTGGAGCTGTATCGCGCGAAAGAGTGGG
ACCAGTTCCTGCGCGGGGCAGTGTTGGCCCACAAGAACATTGTCATATCGGCCGGGACGTACTGTGGCAA
GACCACGTGCCTCAATGCGTTGGTGCAGGAAATCCCCGCGCACGAGCGCATCGTCACGATTGAAGACTCA
CGGGAAATCGAGCCGGCGCAACCAAACTGCGTGCGCCTTTCCTACGCGCGCCATCAGGCATCGGGGCAAG
CTGCCGTGACGCCCACAACGTTGCTTCGCTCGTGCATGCGACTCACCCCCGACCGGGTCATCATGGGCGA
GATTCGCGGCCCGGAAGCGGTTGAGTTCTTGAACATGCTCAACACGGGCCACAAGGGATCGCTCACGACG
ATTCACACCGATTCGCCGGCCGAAATGTATGACCGCTTTGGCGAGTTGATGGACGGTCACACGTCGATGA
CGCGCGAGCAGGTCATCGCGCGCGTCAAGCGACGAATCGACGTTGTTGTGCAGTGGAAATACACCGAGCG
CAACGGTCGCTACATTTCGGAGATCATCTATGCAGGTGCGTGA
 Primer design