SecReT4
Protein ID: 78045297
T4SS name [ID]VirB [633]
Gene symbolvirB8
Locus tagXCVc0032
StrainXanthomonas campestris pv. vesicatoria str. 85-10
Repliconplasmid pXCV38 [GenBank: NC_007506] [Browse all T4SS(s) in this replicon]
Location [Strand]25943..26617 [-]
Producttype IV secretion system protein VirB8
Component typeVirB8
UniProt IDQ3C0D1
KEGG IDxcv:XCVc0032
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 6.4e-41, Aligned region: 23..220
Protein Sequence: 224 a.a.     [Download]
>gi|78045297|ref|YP_361548.1| type IV secretion system protein VirB8 [Xanthomonas campestris pv. vesicatoria str. 85-10]
MNFGKGTFKGDNETQAAQLGGSNKLKQERNRAYLLIGLLLFVVGGMASAVTVLANVHTVIPVVSVIDANG
HVVKQQVVNKETITGQESFVQSQVYDFIMYCNTFDPDWRQRFADLCRLHSTQAVAGQYDAETSPDNPNNP
YYQLGQGGRRYPKITGITSLGKDAYQVSFQSITEKAGSPPKTDYYTALVRYTFTFKPLALGDRWENALGY
ATTAYRKDQELSRQ
 
Nucleotide Sequence: 675 bp     [Download]
>gi|78045265|ref|NC_007506.1|:c26617-25943 Xanthomonas campestris pv. vesicatoria str. 85-10 plasmid pXCV38, complete sequence
ATGAATTTCGGGAAAGGGACGTTTAAAGGCGACAACGAGACGCAGGCGGCCCAATTGGGCGGCTCGAACA
AGCTCAAGCAAGAACGCAACCGCGCGTATCTGCTCATCGGGTTGCTGCTGTTCGTCGTCGGCGGCATGGC
GAGTGCGGTCACGGTGCTCGCCAACGTTCACACGGTCATTCCCGTGGTGTCGGTCATCGACGCGAACGGC
CATGTGGTGAAACAGCAGGTGGTGAACAAGGAAACGATCACGGGGCAGGAAAGCTTCGTTCAGAGTCAGG
TGTACGACTTCATCATGTACTGCAACACGTTCGACCCGGACTGGCGGCAGCGGTTTGCTGACCTCTGCCG
GCTGCACTCAACGCAAGCGGTGGCAGGCCAGTACGACGCGGAAACCAGCCCCGACAACCCGAACAACCCG
TATTACCAGCTCGGGCAGGGCGGTCGGCGCTACCCGAAGATCACGGGCATTACGTCGCTCGGCAAGGATG
CGTATCAGGTGTCGTTCCAGTCGATTACGGAGAAGGCGGGGAGCCCGCCGAAGACCGACTACTACACCGC
GCTCGTCCGCTACACCTTCACGTTCAAACCCCTTGCACTTGGCGACCGCTGGGAAAACGCGCTTGGCTAC
GCCACAACGGCCTACCGCAAGGACCAAGAGCTGAGCCGCCAGTAA
 Primer design