SecReT4
Protein ID: 78045316
T4SS name [ID]Dot/Icm [187]
Gene symboldotB
Locus tagXCVd0007
StrainXanthomonas campestris pv. vesicatoria str. 85-10
Repliconplasmid pXCV183 [GenBank: NC_007507] [Browse all T4SS(s) in this replicon]
Location [Strand]7844..9040 [+]
ProductDotB-like type IV secretion system protein
Component typeDotB
UniProt IDQ3C097
KEGG IDxcv:XCVd0007
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 3.3e-27, Aligned region: 157..286
Protein Sequence: 398 a.a.     [Download]
>gi|78045316|ref|YP_361566.1| DotB-like type IV secretion system protein [Xanthomonas campestris pv. vesicatoria str. 85-10]
MNAVLSDQSLIERALLRSEPTVFDEIGVQQLLVHAKAMGASDVYIKTNARVTARIHGRLYRLTRRTLYAT
EVGSIAGYLYGGPNAEVQLKRGMDLDNAYTFRLNRSDSLRFRWNATGAEIDGSFGISIILRELPEIPPAI
DKEDLGDDLYGALYPDDGIVMVCGPTGSGKSTLLAGMIRDIAENPDSHCHIITYESPVEFVYDKVEKPTT
EIESTSIPDHLPNFAAAIRNSLRRDPDIIVVGEMRDGETIGAAILASQTGHVVYGTAHSTSVGATFTRTM
QSLPKNEQQGMLGGLIDSLRLIICQELVQSTDGKRVALREYLSFGESERRALLTAAMRDPAGVPSVAQQL
TRERGQTKLMHARKLFAAGRIKEDVVLRFELAEQTARAQVSLLAGEGE
 
Nucleotide Sequence: 1197 bp     [Download]
>gi|78045309|ref|NC_007507.1|:7844-9040 Xanthomonas campestris pv. vesicatoria str. 85-10 plasmid pXCV183, complete sequence
ATGAACGCGGTGCTCTCCGACCAGAGCCTGATCGAGCGGGCGCTGCTGCGATCAGAGCCGACTGTCTTCG
ACGAAATCGGTGTCCAACAGCTTCTGGTCCATGCCAAAGCGATGGGCGCCTCGGACGTATACATCAAGAC
GAATGCCAGAGTCACCGCGCGGATCCACGGCCGGCTGTACCGGCTCACGCGCCGCACGCTGTATGCGACG
GAGGTGGGCTCCATTGCCGGCTACCTCTACGGCGGGCCCAACGCCGAGGTTCAGCTCAAGCGCGGGATGG
ACCTGGACAATGCATACACATTCCGCCTCAATCGCTCCGACTCGCTGCGCTTCCGTTGGAACGCGACCGG
CGCGGAGATCGACGGGTCGTTCGGTATCTCGATCATCCTCCGCGAACTTCCCGAGATTCCACCGGCAATC
GACAAAGAAGACTTGGGCGATGACCTCTACGGCGCCTTGTACCCGGACGACGGCATCGTGATGGTTTGCG
GTCCGACCGGATCAGGCAAGTCGACCCTCTTGGCGGGCATGATTCGGGATATCGCAGAGAACCCCGATTC
GCACTGCCACATCATCACCTACGAGTCGCCGGTGGAGTTTGTCTACGACAAGGTCGAGAAGCCGACGACT
GAGATTGAATCGACCTCCATCCCGGATCACCTGCCGAACTTTGCCGCTGCAATCCGCAACTCGCTCCGGC
GTGACCCAGACATCATCGTGGTCGGTGAAATGCGCGACGGCGAGACGATTGGTGCGGCCATCCTTGCTTC
GCAGACAGGTCACGTGGTGTATGGAACGGCACACAGTACTTCTGTCGGCGCTACTTTCACACGCACCATG
CAGAGCCTGCCGAAGAACGAGCAGCAGGGAATGTTGGGTGGCCTCATCGACTCACTGCGCCTCATCATCT
GTCAGGAGCTCGTCCAGTCCACCGACGGCAAGCGCGTGGCGTTGCGTGAGTACCTGTCATTCGGGGAAAG
CGAGCGCCGCGCGCTCCTGACTGCCGCCATGCGGGATCCTGCAGGTGTGCCATCGGTCGCGCAGCAGCTC
ACCCGCGAGCGCGGGCAGACCAAGCTGATGCACGCACGCAAGCTTTTCGCTGCCGGTCGCATCAAAGAGG
ACGTGGTACTCCGCTTCGAGCTCGCCGAGCAGACCGCAAGAGCGCAGGTAAGTTTGCTGGCCGGGGAGGG
TGAGTGA
 Primer design