SecReT4
Protein ID: 78047916
T4SS name [ID]Tfc [684]
Gene symbol-
Locus tagXCV2360
StrainXanthomonas campestris pv. vesicatoria str. 85-10
Repliconchromosome [GenBank: NC_007508] [Browse all T4SS(s) in this replicon]
Location [Strand]2689317..2690840 [-]
Producthypothetical protein
Component typeTfc19
UniProt IDQ3BT22
KEGG IDxcv:XCV2360
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 2.7e-128, Aligned region: 10..492
Protein Sequence: 507 a.a.     [Download]
>gi|78047916|ref|YP_364091.1| hypothetical protein XCV2360 [Xanthomonas campestris pv. vesicatoria str. 85-10]
MTLFTTDYLEYYLTLVSWIVNNGIWAVLVSSGVFALPFVAIVVQEWLKARAEGADEGNKGVLSAARIENR
VFVAIVVVMFAGIPFIDVDLSTIQYDSSRSAQCQVSVPQPAETGWSQSFSTINNQSAKVPVWWAFMHALS
RAVTSASVAAIPCGTDLRQMRMEIDATRIDDPVLAQEVADFSRDCYGPARAKLFMQRPDLDEQQMHDVTW
IGSRFFTDTGGYYDSYRSSTAREAWPYDDTRDAGLAQVANGGGYPTCRQWWSDGSNGLRARLLGQVDPSL
LNRLAGWAGFLSRAEVDDSVIRAIASPRQQKLNQGSVYTDYGGQIDKSLPNIVTRAAGDVGMTVGAIAAF
PAMDVVRQAVPMVLALLKMALVICIPLVLLVGTYDLKTVVTVSVVQFALFFTDFWFQLARWIDSTILDAL
YGWGFGWNRPHTNFDPLVGLNNAFGDMLMMFVMGTMFIVLPTFWIMALAWAGVRAGNVLQGLAGATADAK
AAGGKGGSIAINAVAKK
 
Nucleotide Sequence: 1524 bp     [Download]
>gi|78045556|ref|NC_007508.1|:c2690840-2689317 Xanthomonas campestris pv. vesicatoria str. 85-10 chromosome, complete genome
ATGACGCTTTTCACGACCGACTACCTGGAGTACTACCTCACCCTCGTGTCCTGGATCGTCAACAACGGCA
TCTGGGCCGTACTGGTGTCCAGCGGTGTGTTCGCGCTGCCGTTCGTCGCCATCGTCGTGCAGGAATGGCT
GAAGGCCCGCGCAGAAGGCGCTGACGAAGGTAACAAGGGTGTGCTCTCGGCCGCGCGCATCGAGAACCGG
GTCTTCGTCGCCATCGTGGTGGTGATGTTCGCCGGCATTCCGTTCATCGACGTGGACCTCAGCACCATCC
AATACGACAGCTCACGCTCGGCACAGTGCCAAGTCAGCGTGCCGCAGCCCGCGGAGACCGGCTGGTCGCA
GTCTTTCAGCACCATCAACAACCAGTCGGCGAAGGTGCCGGTCTGGTGGGCCTTCATGCACGCGCTTTCG
CGTGCCGTCACGAGCGCCTCGGTGGCTGCGATCCCGTGCGGCACTGACCTGCGGCAGATGCGGATGGAGA
TCGACGCGACCCGTATCGACGACCCGGTGCTGGCCCAGGAAGTGGCGGATTTCTCGCGGGACTGCTACGG
GCCGGCGCGCGCCAAGCTGTTCATGCAGCGCCCGGATCTCGATGAGCAACAGATGCACGACGTGACCTGG
ATCGGCTCGCGCTTTTTCACGGACACGGGTGGCTACTACGACAGTTACCGCTCCAGCACGGCGCGCGAAG
CATGGCCCTATGACGACACCCGCGATGCGGGGCTCGCGCAGGTAGCCAATGGCGGCGGCTACCCGACTTG
CAGGCAGTGGTGGTCAGACGGCAGCAACGGCCTGCGCGCGCGGCTGCTGGGGCAAGTGGACCCGAGCCTG
CTGAATCGCCTGGCGGGCTGGGCCGGGTTCCTGAGCCGGGCCGAGGTGGACGATTCGGTGATCCGCGCCA
TCGCGTCACCGCGGCAGCAGAAATTGAACCAGGGCAGCGTCTATACGGACTACGGCGGTCAGATCGACAA
GTCCTTACCGAACATCGTCACCCGTGCCGCGGGCGATGTGGGGATGACAGTCGGGGCGATCGCCGCATTC
CCCGCCATGGATGTAGTACGCCAGGCCGTACCGATGGTGCTCGCCCTGCTCAAGATGGCGCTGGTCATCT
GCATCCCGCTTGTGCTGCTCGTGGGCACCTACGACCTCAAGACAGTCGTTACCGTCAGCGTCGTGCAGTT
CGCGCTGTTCTTCACGGATTTCTGGTTCCAACTCGCCCGCTGGATCGACAGCACCATCCTCGATGCGCTC
TATGGGTGGGGCTTCGGGTGGAACCGGCCGCATACCAACTTCGATCCGCTGGTGGGGCTGAACAACGCCT
TCGGCGACATGCTCATGATGTTCGTCATGGGCACGATGTTCATCGTGCTGCCTACGTTCTGGATCATGGC
GCTGGCTTGGGCGGGCGTTCGCGCCGGCAACGTCCTGCAAGGCCTCGCCGGGGCGACCGCTGATGCCAAG
GCCGCCGGCGGGAAAGGCGGAAGTATCGCGATCAATGCAGTGGCGAAGAAGTGA
 Primer design