SecReT4
Protein ID: 78047918
T4SS name [ID]Tfc [684]
Gene symbol-
Locus tagXCV2362
StrainXanthomonas campestris pv. vesicatoria str. 85-10
Repliconchromosome [GenBank: NC_007508] [Browse all T4SS(s) in this replicon]
Location [Strand]2691223..2692620 [-]
Producthypothetical protein
Component typeTfc22
UniProt IDQ3BT20
KEGG IDxcv:XCV2362
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 465 a.a.     [Download]
>gi|78047918|ref|YP_364093.1| hypothetical protein XCV2362 [Xanthomonas campestris pv. vesicatoria str. 85-10]
MKIRTALNPLSRQARHTKIVLALAGTLALASGVAWGQLGYQTSGSVIGDDVMYSIGGGSAVSMGRAAGMR
SLGVGVGWNSNLICGDMSIQTTLKNQLNGITNGFQQIMSSVIQSATSAVASLPALIIQRADPGLYNLLTN
GVLQARLDFDRSKLTCRAMAEKMADTAGGQLGWSQMAEGLALRDAVSSTDAVSAIEQAETRRGNDGVPWI
GGSNAGGSGQPAIKVVGDVTRAGYNLVNGRGVTDTSSIAPSSCSSLSCQTWASPQAAVEWATRVLGEKEQ
RTCDACTKTETTPGVGLTPLIQEEYDAKLQALQGLVSKAKNTTPENLREAGSASLPITRGVIEALRDEPD
QHLLSQRLASEVALSSVLEKALLLQRTLLTGKKEPNVAANELAVDAVNKESDTLDREIRNLKTELELRRE
LANNSPMAIIQRHGARATGSRGIYEGDPVPDRLDQLQKGNPGSQP
 
Nucleotide Sequence: 1398 bp     [Download]
>gi|78045556|ref|NC_007508.1|:c2692620-2691223 Xanthomonas campestris pv. vesicatoria str. 85-10 chromosome, complete genome
ATGAAGATTCGTACCGCACTCAATCCGCTCTCCCGCCAGGCACGCCACACGAAGATCGTCCTGGCGCTGG
CCGGCACGCTCGCGCTGGCCAGCGGCGTGGCCTGGGGCCAACTGGGCTACCAGACCAGCGGCAGCGTCAT
CGGCGATGACGTCATGTACTCGATCGGCGGCGGCAGTGCCGTGTCGATGGGACGCGCGGCCGGCATGCGC
TCCCTCGGGGTGGGCGTGGGCTGGAACAGCAACTTGATCTGCGGCGACATGAGCATCCAGACCACGTTGA
AGAACCAGCTCAACGGCATCACCAACGGCTTCCAGCAAATCATGTCGTCAGTGATCCAGAGCGCCACCAG
CGCGGTGGCGTCTTTGCCTGCGCTGATCATCCAGCGCGCCGATCCCGGCCTCTACAACCTGCTTACCAAT
GGCGTGCTGCAGGCACGTCTCGATTTCGACCGCTCCAAGCTGACGTGCCGTGCCATGGCCGAGAAGATGG
CCGACACGGCAGGCGGCCAGCTCGGCTGGAGCCAGATGGCCGAAGGCTTGGCGCTGCGCGATGCTGTGTC
GAGTACGGATGCGGTCTCGGCCATCGAGCAGGCCGAGACGCGCCGCGGCAATGACGGCGTGCCGTGGATC
GGGGGCAGCAACGCGGGCGGCTCCGGTCAGCCCGCAATCAAGGTCGTCGGCGATGTCACCCGCGCCGGCT
ACAACCTGGTCAACGGCCGCGGCGTGACCGATACGTCGTCCATCGCGCCGTCCAGTTGCAGCAGCCTCTC
GTGCCAGACCTGGGCCTCGCCGCAGGCGGCCGTCGAGTGGGCCACGCGCGTGCTCGGCGAGAAGGAACAA
CGCACTTGCGATGCCTGCACAAAGACCGAGACGACGCCCGGCGTCGGGCTGACGCCGCTGATCCAGGAAG
AGTACGACGCGAAGCTGCAGGCGCTCCAGGGTCTCGTCTCCAAGGCGAAGAACACGACGCCGGAGAACCT
GCGCGAGGCCGGCAGTGCATCGCTGCCGATCACGCGCGGCGTGATCGAAGCACTGCGCGACGAGCCCGAC
CAGCATCTGCTGTCGCAGCGCCTGGCGTCCGAGGTCGCGCTGTCGTCCGTGCTGGAGAAAGCGCTGCTGC
TGCAGCGCACGCTGCTCACGGGGAAGAAGGAGCCCAACGTCGCGGCCAACGAGCTTGCGGTGGATGCCGT
AAACAAGGAGAGCGACACACTCGACCGCGAAATCCGCAACCTCAAGACGGAACTGGAGCTGCGGCGCGAG
CTGGCGAACAATTCGCCCATGGCGATCATCCAGCGCCACGGCGCGCGCGCGACTGGCTCGCGCGGCATCT
ACGAGGGCGACCCGGTGCCTGATCGTCTCGACCAGCTCCAGAAGGGCAATCCGGGGAGTCAGCCATGA
 Primer design