SecReT4
Protein ID: 78047919
T4SS name [ID]Tfc [684]
Gene symbol-
Locus tagXCV2363
StrainXanthomonas campestris pv. vesicatoria str. 85-10
Repliconchromosome [GenBank: NC_007508] [Browse all T4SS(s) in this replicon]
Location [Strand]2692630..2693577 [-]
Producthypothetical protein
Component typeTfc23
UniProt IDQ3BT19
KEGG IDxcv:XCV2363
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 4.5e-95, Aligned region: 33..303
Protein Sequence: 315 a.a.     [Download]
>gi|78047919|ref|YP_364094.1| hypothetical protein XCV2363 [Xanthomonas campestris pv. vesicatoria str. 85-10]
MTRPFDLLRRLRAGVASVLLLSATGSYALDTATVVGSVASPDCLEYRVVGICYWLYCTWTGCTVRTSIKV
RHYIPDAVVSSYSNTGENPWVEVRAMSTPNPSAQAGGDGTTNEDHENDLAKFKNADVIGHPGVEVFNQFV
SSSGYFCEGAGTAFMPYLLSTLDTLAWRYNVPEMAYPEALVPGMREVGARTTMNLWGNVYPRGGFLHQTD
DHKAGAVVAQRAGDVVTRRGQIHVYQPLLADSRPGYWPAGALVEGDASTGKWQELTPVLSSSCTVFPRND
FLTQAQQGDYAWALWRPYACCERKGQVFLGSVDFN
 
Nucleotide Sequence: 948 bp     [Download]
>gi|78045556|ref|NC_007508.1|:c2693577-2692630 Xanthomonas campestris pv. vesicatoria str. 85-10 chromosome, complete genome
GTGACCCGACCATTCGACCTGTTGAGGCGCCTGCGCGCTGGCGTGGCGTCCGTGCTGCTACTCAGTGCCA
CCGGAAGCTACGCCCTCGACACCGCCACCGTCGTCGGCTCGGTGGCATCGCCCGACTGCCTCGAATACCG
GGTCGTCGGCATCTGCTACTGGCTCTACTGCACTTGGACCGGCTGCACCGTGCGCACGTCTATCAAGGTT
CGCCACTACATCCCCGATGCCGTCGTCTCCAGCTACAGCAATACCGGCGAGAACCCCTGGGTCGAAGTCC
GGGCGATGAGCACGCCCAACCCATCCGCCCAAGCAGGCGGCGACGGAACCACGAACGAAGACCACGAGAA
CGACCTCGCCAAGTTCAAGAACGCCGACGTGATCGGCCACCCTGGCGTCGAGGTGTTCAACCAGTTCGTC
TCGTCGTCGGGCTACTTCTGCGAGGGCGCGGGTACGGCGTTCATGCCGTACTTGCTCAGCACGCTGGATA
CGCTGGCCTGGCGCTACAACGTGCCCGAGATGGCCTACCCGGAAGCGCTGGTTCCAGGCATGCGCGAGGT
CGGCGCACGCACCACGATGAACCTCTGGGGCAACGTGTATCCCCGTGGCGGCTTCCTGCACCAGACCGAC
GACCACAAAGCTGGTGCCGTGGTGGCCCAACGTGCAGGTGATGTTGTCACGCGCCGCGGGCAGATCCACG
TCTATCAGCCGCTGCTCGCCGATTCGCGGCCCGGCTACTGGCCTGCCGGCGCGCTGGTGGAGGGCGACGC
ATCGACCGGGAAGTGGCAGGAACTCACGCCCGTTCTGTCCTCGTCCTGCACGGTTTTCCCGCGTAACGAT
TTCCTGACCCAGGCCCAGCAAGGCGACTACGCCTGGGCATTGTGGCGGCCCTATGCCTGCTGCGAACGCA
AGGGCCAGGTCTTCCTCGGCAGCGTCGATTTCAACTGA
 Primer design