SecReT4
Protein ID: 78047920
T4SS name [ID]Tfc [684]
Gene symbol-
Locus tagXCV2364
StrainXanthomonas campestris pv. vesicatoria str. 85-10
Repliconchromosome [GenBank: NC_007508] [Browse all T4SS(s) in this replicon]
Location [Strand]2693574..2694020 [-]
Producthypothetical protein
Component typeTfc24
UniProt IDQ3BT18
KEGG IDxcv:XCV2364
PDB IDNA
Domain hit(s) vs Pfam DUF1525 [PF07511], Evalue: 2.3e-39, Aligned region: 35..145
Protein Sequence: 148 a.a.     [Download]
>gi|78047920|ref|YP_364095.1| hypothetical protein XCV2364 [Xanthomonas campestris pv. vesicatoria str. 85-10]
MPASLSRFAPGWRTLGLAVALPAALAVFSPATFAADVVVVTDSRHPVKTMGGERLIELDEAHRIEAELSA
GLSADSEQATVIVRRRLSSGGADLQRHIASAYQGVTDAWSLGITGIPAVVVDQRYVVYGEPDVARAVARI
EQYRRNQP
 
Nucleotide Sequence: 447 bp     [Download]
>gi|78045556|ref|NC_007508.1|:c2694020-2693574 Xanthomonas campestris pv. vesicatoria str. 85-10 chromosome, complete genome
ATGCCAGCATCTCTTTCCAGGTTCGCGCCGGGCTGGCGAACCCTCGGCCTGGCCGTCGCGCTGCCGGCCG
CCCTGGCCGTTTTCAGCCCGGCCACCTTCGCCGCCGACGTAGTGGTCGTCACCGACAGTCGCCACCCGGT
CAAGACCATGGGCGGCGAACGGCTGATCGAACTGGACGAAGCCCACCGGATTGAAGCGGAGCTTTCGGCG
GGACTGTCCGCCGACTCCGAACAGGCAACAGTCATCGTCAGGCGCCGGCTCTCCAGCGGCGGTGCCGATC
TCCAGCGACACATCGCTTCCGCATACCAGGGCGTCACAGACGCATGGAGCCTGGGCATCACCGGCATCCC
GGCCGTCGTCGTAGACCAACGCTACGTGGTCTACGGCGAACCGGACGTGGCTCGCGCCGTCGCGCGCATC
GAGCAGTACCGGAGGAACCAGCCGTGA
 Primer design