SecReT4
Protein ID: 78047923
T4SS name [ID]Tfc [684]
Gene symbol-
Locus tagXCV2367
StrainXanthomonas campestris pv. vesicatoria str. 85-10
Repliconchromosome [GenBank: NC_007508] [Browse all T4SS(s) in this replicon]
Location [Strand]2695658..2698525 [-]
Producthypothetical protein
Component typeTfc16
UniProt IDQ3BT15
KEGG IDxcv:XCV2367
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 1.5e-68, Aligned region: 61..336
AAA_10 [PF12846], Evalue: 7e-46, Aligned region: 529..868
Protein Sequence: 955 a.a.     [Download]
>gi|78047923|ref|YP_364098.1| hypothetical protein XCV2367 [Xanthomonas campestris pv. vesicatoria str. 85-10]
MRWKLPWPKLAASSASDDEQPDGWQRHVDALRQAGIPEPGAAVQGRRPATVADEQALYDVAPSFAELLPW
VEFLPQSKSMLLEDGQSVAAFYELVPLGTEGREPGWLAHARDALENALQDSFDELDENPWVLQLYAQDEP
SFDQYMQTLRDYVQPRARDTAFTEFYLRFFGHHLRAVAKPGGLFEDTVVTRLRWRGQTRRVRMVIYRRAT
GQASRRGQTPEQMLNIVCDRLCGGLANAGIQARRMVAADVHDWLLRWFNPRPAMLGPSAEDRERFYALAR
YPDETEEGEIELASGRDFSQRLFFGQPRSDVEHGTWYFDGMPHRVLITDRLRMPPATGHLTGETRKGDAI
NTLFDQMPEDTLMCLTMVATPQDVLEADLNHLAKKAVGETLASEQTLKDVQEARSLIGSAHKLYRGTLAF
YLRGRDEAELDRRGLDLANVMLNAGLQPVREDDEVAPLNSYLRWLPCCYNPGQDRRRWYTQLMFAQHIAN
VSPVWGRAQGTGHPGITVFNRGGGPITFDPLNRLDRQMNAHLFLFGPTGSGKSATLNNLLNQVTAIYRPR
LFIVEAGNSFGLFSDFAKRLGLTVNRVKLAPGSGISLAPFADARRLIETPSDVQTLDADALDEDLPPDVA
AMEADEQRDVLGELEITARLMITGGEDKEEARMTRADRSLIRQCILDAAEHCVAEKRTVLTRDVRNALRT
RGQDPTLPEMRRVRLLEMADAMDMFCQGTDGEMFDRDGTPWPEADITLVDLATYAREGYNAQLSIAYISL
ISTVNNIAERDQYLGRPIINVTDEGHIITKNPLLAPYVVKITKMWRKLGAWFWLATQNIDDLPRAAEPML
NMIEWWICLSMPPDEVEKIARFRELSPAQKALMLSARKEAGKFTEGVILSKSMEVLFRAVPPSLYLALAQ
TEPEEKAERYQLMQQYGCTELEAAFKVAEKIDQARGIESPALELS
 
Nucleotide Sequence: 2868 bp     [Download]
>gi|78045556|ref|NC_007508.1|:c2698525-2695658 Xanthomonas campestris pv. vesicatoria str. 85-10 chromosome, complete genome
ATGCGCTGGAAACTTCCCTGGCCGAAGCTGGCCGCATCCAGCGCCAGCGACGACGAGCAGCCGGACGGTT
GGCAGCGCCACGTCGATGCCTTGCGCCAGGCCGGCATCCCCGAACCTGGCGCAGCGGTCCAGGGCCGCAG
GCCGGCGACGGTAGCCGACGAGCAGGCGCTGTACGACGTCGCACCGTCGTTCGCGGAACTGCTGCCTTGG
GTGGAGTTCCTGCCGCAGTCGAAGTCCATGCTGCTGGAGGATGGGCAGTCGGTCGCTGCCTTCTACGAGC
TGGTGCCGCTGGGCACCGAGGGCCGGGAACCCGGCTGGCTTGCGCATGCCCGCGATGCCTTGGAGAACGC
GCTCCAGGACTCGTTCGATGAGCTGGACGAAAACCCCTGGGTGCTCCAGCTCTACGCCCAGGACGAGCCC
AGCTTCGACCAGTACATGCAGACCCTGCGCGACTATGTGCAGCCGCGCGCCCGGGATACCGCGTTCACCG
AATTCTACCTGCGCTTCTTCGGCCACCATCTGCGCGCGGTCGCCAAGCCGGGCGGCCTGTTCGAGGACAC
GGTAGTCACGCGGCTGCGCTGGCGCGGCCAGACGCGGCGGGTGCGCATGGTGATCTATCGCCGTGCCACC
GGGCAGGCAAGCCGCCGCGGCCAGACACCCGAGCAGATGCTGAACATCGTCTGCGACCGCCTGTGCGGCG
GCTTGGCGAACGCCGGCATCCAGGCACGGCGCATGGTCGCAGCCGACGTCCACGACTGGCTGCTGCGGTG
GTTCAATCCGCGCCCCGCGATGCTCGGGCCGAGTGCAGAGGACCGGGAGCGCTTCTACGCGCTGGCGCGC
TACCCCGACGAGACCGAGGAAGGCGAAATCGAGCTGGCGAGCGGGCGGGATTTCAGCCAGCGGTTGTTCT
TCGGCCAGCCACGCTCCGACGTGGAGCACGGCACCTGGTACTTCGACGGCATGCCGCACCGTGTGCTGAT
CACCGACCGGCTCCGCATGCCGCCCGCCACGGGTCACCTGACGGGCGAAACCCGCAAGGGCGATGCGATC
AACACCCTGTTCGACCAGATGCCGGAAGACACCTTGATGTGTCTCACCATGGTCGCCACACCGCAGGATG
TGCTGGAAGCGGACTTGAACCACCTGGCGAAGAAGGCCGTGGGCGAGACGCTGGCGTCGGAGCAGACGCT
CAAGGACGTGCAGGAGGCGCGGTCCCTGATCGGCAGCGCGCACAAGCTCTACCGGGGAACGCTGGCGTTC
TACCTGCGCGGGCGCGACGAGGCGGAACTGGACCGGCGCGGCCTGGACCTGGCGAACGTGATGCTCAACG
CCGGCTTGCAGCCGGTGCGCGAGGACGACGAGGTGGCGCCACTCAACAGCTACTTGCGCTGGCTGCCGTG
CTGCTACAACCCCGGCCAGGATCGGCGCAGGTGGTACACCCAACTGATGTTCGCGCAGCACATCGCGAAC
GTATCGCCGGTGTGGGGCCGCGCCCAGGGTACCGGGCATCCCGGCATCACCGTGTTCAACCGCGGCGGCG
GCCCGATCACGTTCGATCCGCTCAACCGCCTAGACCGACAGATGAACGCCCACTTGTTCCTGTTCGGCCC
CACCGGCTCCGGCAAGAGCGCCACGCTCAACAACCTATTGAATCAGGTCACGGCCATCTACCGGCCAAGG
CTGTTCATCGTGGAAGCCGGCAACAGCTTCGGCCTGTTCAGCGACTTCGCCAAGCGCCTGGGCCTGACCG
TGAACCGGGTCAAGCTGGCCCCCGGCTCGGGCATCAGCCTGGCCCCCTTCGCCGACGCGCGCCGGCTGAT
CGAGACGCCCAGCGACGTGCAGACGCTCGATGCCGATGCGCTGGACGAAGACCTGCCACCGGATGTCGCG
GCGATGGAGGCAGACGAGCAGCGCGACGTGCTGGGCGAACTGGAGATCACGGCACGGCTGATGATCACCG
GCGGCGAGGACAAGGAAGAAGCCCGGATGACGCGGGCCGATCGCTCGCTTATCCGCCAGTGCATCCTCGA
CGCCGCCGAGCACTGCGTGGCCGAGAAGCGCACGGTGCTCACGCGCGACGTGCGCAATGCACTGCGCACC
CGCGGCCAGGACCCAACGCTGCCCGAGATGCGCCGCGTGCGACTGCTGGAAATGGCGGATGCGATGGATA
TGTTCTGCCAAGGCACAGATGGCGAGATGTTTGACCGCGACGGCACACCATGGCCGGAAGCCGACATCAC
CCTGGTCGATCTGGCGACCTACGCCCGCGAGGGCTACAACGCACAGCTCTCCATCGCCTATATCAGCCTG
ATCAGCACGGTGAACAACATCGCCGAACGCGACCAGTATTTGGGGCGCCCGATCATCAATGTGACCGACG
AAGGACACATCATCACGAAGAATCCGCTGCTCGCGCCCTACGTCGTGAAAATTACAAAGATGTGGAGGAA
ATTGGGGGCCTGGTTCTGGCTCGCGACGCAGAACATCGACGACCTGCCACGCGCCGCGGAGCCAATGCTC
AACATGATCGAGTGGTGGATCTGCCTCAGCATGCCACCCGATGAAGTCGAGAAGATCGCGCGGTTCCGCG
AACTCTCGCCCGCGCAGAAGGCGCTGATGCTGTCGGCCCGCAAGGAGGCGGGCAAGTTCACCGAGGGAGT
CATCCTCTCCAAGAGCATGGAAGTGCTGTTCCGCGCCGTGCCGCCAAGCCTGTACCTCGCGCTTGCGCAG
ACCGAACCCGAAGAGAAGGCCGAGCGCTACCAGCTCATGCAGCAATACGGCTGCACCGAACTGGAAGCGG
CCTTCAAGGTAGCCGAGAAGATCGACCAAGCACGCGGCATCGAGTCGCCGGCCTTGGAACTGTCGTAA
 Primer design