SecReT4
Protein ID: 78047924
T4SS name [ID]Tfc [684]
Gene symbol-
Locus tagXCV2368
StrainXanthomonas campestris pv. vesicatoria str. 85-10
Repliconchromosome [GenBank: NC_007508] [Browse all T4SS(s) in this replicon]
Location [Strand]2698525..2698965 [-]
Producthypothetical protein
Component typeTfc15
UniProt IDQ3BT14
KEGG IDxcv:XCV2368
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 146 a.a.     [Download]
>gi|78047924|ref|YP_364099.1| hypothetical protein XCV2368 [Xanthomonas campestris pv. vesicatoria str. 85-10]
MLSNLNRGLALALAVAVLGGCATSKEKLLPHGDSTMMDIWQQNAGDGGGSAGQAARRQLLDARQSLRRPL
TEADVQAAPAEQTRYTRTARNEVYRQFHRLPNPDLVMYVYPHLAGSDPVPVPGYTTVFPLYQRVQYAMPG
ERVEEY
 
Nucleotide Sequence: 441 bp     [Download]
>gi|78045556|ref|NC_007508.1|:c2698965-2698525 Xanthomonas campestris pv. vesicatoria str. 85-10 chromosome, complete genome
ATGCTCTCGAACTTGAATAGGGGCCTGGCGCTGGCCCTCGCCGTCGCGGTGCTCGGCGGCTGCGCCACCA
GCAAGGAAAAGCTGCTGCCCCACGGCGACAGCACGATGATGGACATCTGGCAGCAGAACGCCGGCGACGG
CGGCGGGAGCGCCGGCCAGGCGGCACGCCGGCAGTTGCTCGATGCCCGCCAGAGCCTGCGCCGGCCGCTG
ACCGAGGCCGACGTGCAGGCCGCGCCCGCCGAGCAGACGCGCTACACGCGCACCGCGCGCAACGAGGTCT
ATCGCCAGTTCCACCGGCTGCCGAATCCCGATCTCGTCATGTACGTGTATCCGCACCTGGCGGGCTCGGA
CCCTGTACCTGTGCCGGGCTACACGACGGTCTTCCCCCTCTATCAGCGCGTGCAGTACGCCATGCCGGGC
GAGCGCGTGGAGGAATACTGA
 Primer design