SecReT4
Protein ID: 78047925
T4SS name [ID]Tfc [684]
Gene symbol-
Locus tagXCV2369
StrainXanthomonas campestris pv. vesicatoria str. 85-10
Repliconchromosome [GenBank: NC_007508] [Browse all T4SS(s) in this replicon]
Location [Strand]2698946..2700376 [-]
Producthypothetical protein
Component typeTfc14
UniProt IDQ3BT13
KEGG IDxcv:XCV2369
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 476 a.a.     [Download]
>gi|78047925|ref|YP_364100.1| hypothetical protein XCV2369 [Xanthomonas campestris pv. vesicatoria str. 85-10]
MRSNGLLKWLMIPVALLVLFVAIRLFSGGSTSAPPAADAGSKLTPEEMKALGIEGDTPRDTVATLVAQVK
QLRTELQTALTDNKSQREENQRLRQRENSIDQRINSALESERSNLRRDQEQAASARQQTEGLLADLQRRL
DSIGGRGGGHADLPVGLGLRDGDEAGMEGGMRWVEPDDAKKAEGRNGSRGAGSGMSFPTSFGPAQSTLET
TAETVANAGARAAGVKSAKPVYTVPTNSTLMGSVAMTALIGRVPIDGTVNDPYPFKILVGPDNLTANGID
IPDVAGAVFSGTASGDWTLSCVRGQVRSITFVFHDGTIRTIPEDRDGNQQNNQQQNSQTGGLGWISDPYG
IPCVSGERRSNAQQYLGSQALITAAGAGVASLIDSDSGQMSYVGADGSIGSVGISGNEAVGRILAGGVRD
MADWVNKLYGQAFAAVYVQPGAKVAVHLEKPLAIDFDPEGRKVDHRAGESHALELE
 
Nucleotide Sequence: 1431 bp     [Download]
>gi|78045556|ref|NC_007508.1|:c2700376-2698946 Xanthomonas campestris pv. vesicatoria str. 85-10 chromosome, complete genome
ATGCGCAGTAACGGCTTGCTCAAGTGGCTGATGATCCCGGTCGCCTTGCTGGTGCTGTTCGTTGCCATCC
GACTGTTCTCCGGCGGAAGCACGTCGGCACCGCCCGCCGCGGATGCCGGTTCCAAGCTCACGCCCGAGGA
AATGAAGGCGTTGGGCATCGAAGGCGATACCCCGCGCGATACCGTGGCAACGCTCGTCGCCCAGGTGAAG
CAGTTGCGCACCGAGCTTCAGACCGCGCTGACCGACAACAAGTCGCAGCGCGAGGAAAACCAGCGCCTGC
GCCAGCGCGAGAACTCCATCGATCAGCGCATCAATTCGGCCCTCGAATCCGAACGCTCGAACCTGCGCCG
CGACCAGGAACAGGCGGCCAGTGCGCGCCAGCAGACCGAAGGGCTGCTCGCCGACCTGCAGCGGCGTCTG
GACAGCATCGGCGGGCGCGGCGGCGGCCATGCCGATCTGCCCGTGGGCCTGGGGCTGCGCGACGGCGACG
AGGCCGGCATGGAAGGCGGCATGCGCTGGGTCGAACCGGACGACGCGAAGAAGGCCGAGGGACGCAACGG
CAGTCGTGGCGCGGGCAGCGGCATGAGCTTCCCGACGAGCTTCGGCCCGGCGCAAAGCACGCTGGAAACG
ACCGCGGAAACCGTGGCGAACGCCGGCGCACGTGCGGCAGGCGTCAAGAGCGCCAAGCCGGTCTATACCG
TGCCAACCAACTCGACGCTGATGGGGTCGGTCGCGATGACGGCGCTGATCGGCCGCGTGCCGATCGACGG
GACGGTGAACGACCCGTATCCGTTCAAAATCCTGGTCGGCCCAGACAACCTGACCGCGAACGGGATTGAC
ATCCCGGACGTGGCCGGCGCCGTGTTCTCCGGCACCGCATCGGGCGACTGGACGCTTTCGTGCGTGCGCG
GTCAGGTGCGCAGCATCACCTTCGTCTTCCACGACGGCACGATCCGCACCATCCCCGAAGACCGCGACGG
CAACCAGCAGAACAACCAGCAGCAGAACTCTCAAACCGGGGGCCTGGGCTGGATCAGCGATCCGTATGGC
ATCCCTTGCGTCAGCGGCGAGCGGCGCAGCAACGCCCAGCAGTACCTCGGCTCGCAGGCCCTGATCACCG
CGGCCGGTGCCGGCGTGGCCTCGCTGATCGACAGCGACAGCGGCCAGATGTCCTACGTCGGCGCCGACGG
TTCCATCGGCAGCGTCGGCATCTCGGGCAACGAGGCCGTGGGCCGCATCCTGGCCGGTGGCGTGCGCGAC
ATGGCGGACTGGGTGAACAAGCTGTACGGGCAGGCGTTCGCGGCCGTCTATGTCCAGCCCGGCGCGAAGG
TCGCCGTCCACCTCGAAAAGCCGCTCGCCATCGACTTCGATCCCGAAGGCCGCAAGGTCGATCACCGCGC
AGGAGAAAGCCATGCTCTCGAACTTGAATAG
 Primer design