SecReT4
Protein ID: 78047926
T4SS name [ID]Tfc [684]
Gene symbol-
Locus tagXCV2370
StrainXanthomonas campestris pv. vesicatoria str. 85-10
Repliconchromosome [GenBank: NC_007508] [Browse all T4SS(s) in this replicon]
Location [Strand]2700366..2701280 [-]
Producthypothetical protein
Component typeTfc13
UniProt IDQ3BT12
KEGG IDxcv:XCV2370
PDB IDNA
Domain hit(s) vs Pfam DUF3438 [PF11920], Evalue: 5.4e-127, Aligned region: 3..286
Protein Sequence: 304 a.a.     [Download]
>gi|78047926|ref|YP_364101.1| hypothetical protein XCV2370 [Xanthomonas campestris pv. vesicatoria str. 85-10]
MKHPVLTLLGLLAVAVAPAQAVEILRWERMPLAVPLKVGQERIVFIDRNVRVGVPAGVGERLRVQSAGGA
VYLRASEPIEPTRLQLQDADTGALILLDIAAEPPKDGEAELEPVRIVEGSSTPARYGDQAGGADEDPARA
QDQSVARAARRETPVPVVLTRFAAQNLYAPLRTVEPLAGVMRVNLRRGLDLGTLMPTLPVRAVALASWRL
EDQWVTAVRLTNSSSGWVTLDPRVLQGDFLTATFQHEALGPRGTPEDTTVLYLVTRGRGLAQSLLPAIHR
FDPAAHLPQPEAEAEDGKEARHAQ
 
Nucleotide Sequence: 915 bp     [Download]
>gi|78045556|ref|NC_007508.1|:c2701280-2700366 Xanthomonas campestris pv. vesicatoria str. 85-10 chromosome, complete genome
ATGAAGCATCCTGTACTCACGCTGCTGGGGCTGCTGGCCGTCGCCGTGGCCCCCGCTCAGGCGGTGGAAA
TCCTGCGCTGGGAGCGCATGCCGCTGGCGGTGCCGCTGAAGGTCGGCCAGGAGCGCATCGTGTTCATCGA
CCGGAACGTCCGCGTGGGCGTGCCCGCAGGCGTGGGCGAACGCCTGCGCGTGCAGAGCGCGGGTGGCGCG
GTGTACCTGCGCGCCAGCGAGCCGATCGAGCCCACGCGGCTGCAATTGCAGGACGCCGACACCGGCGCGC
TGATCCTGCTCGACATCGCGGCCGAGCCGCCCAAGGACGGCGAAGCCGAGCTGGAGCCGGTGCGCATCGT
CGAGGGCAGCAGCACCCCGGCGCGCTATGGCGATCAGGCAGGCGGTGCCGACGAGGACCCGGCGCGCGCC
CAGGACCAGTCAGTCGCTCGGGCAGCGCGGCGCGAGACGCCGGTTCCGGTCGTCCTGACGCGCTTCGCCG
CGCAGAACCTCTACGCGCCCCTGCGCACCGTGGAGCCGCTGGCGGGCGTCATGCGGGTGAACCTGCGCCG
TGGCCTCGACCTTGGCACGCTGATGCCGACGCTGCCCGTGCGCGCGGTCGCTCTCGCGTCGTGGCGTCTG
GAAGACCAGTGGGTCACCGCCGTGCGTCTGACCAACAGCAGCAGCGGCTGGGTCACGCTCGACCCGCGCG
TGCTGCAAGGCGATTTCCTCACCGCCACCTTCCAGCACGAAGCGCTCGGCCCCCGCGGGACGCCCGAGGA
CACGACCGTCCTGTACCTGGTGACACGCGGACGCGGCCTCGCGCAATCGCTGCTGCCGGCGATCCACCGC
TTCGACCCGGCTGCGCACCTGCCGCAGCCGGAAGCGGAAGCCGAGGACGGCAAGGAGGCCCGCCATGCGC
AGTAA
 Primer design