SecReT4
Protein ID: 78047927
T4SS name [ID]Tfc [684]
Gene symbol-
Locus tagXCV2371
StrainXanthomonas campestris pv. vesicatoria str. 85-10
Repliconchromosome [GenBank: NC_007508] [Browse all T4SS(s) in this replicon]
Location [Strand]2701277..2701969 [-]
Producthypothetical protein
Component typeTfc12
UniProt IDQ3BT11
KEGG IDxcv:XCV2371
PDB IDNA
Domain hit(s) vs Pfam DUF2895 [PF11444], Evalue: 5.9e-90, Aligned region: 6..206
Protein Sequence: 230 a.a.     [Download]
>gi|78047927|ref|YP_364102.1| hypothetical protein XCV2371 [Xanthomonas campestris pv. vesicatoria str. 85-10]
MSRFKNEISHLQAHIKTLRLGAGALVVVALVMGAGWWSAPRDLTIHVPPDLRSGSTRKWWEVPPESVYAF
TFYVFQTLNRWPTNGEEDYARNLHTLSPYLTPSCQAFLRADYDYRRSTGELRQRVRGIYEIPGRGYGDDP
TARVRVVSDRDWVVTLDITADEYYGAEQVKRALVRYPVKVTRVDVDPARNPFGLALDCYDGAPQRISAPE
PTRPAPGGLSPQAPQGENTP
 
Nucleotide Sequence: 693 bp     [Download]
>gi|78045556|ref|NC_007508.1|:c2701969-2701277 Xanthomonas campestris pv. vesicatoria str. 85-10 chromosome, complete genome
ATGAGCCGTTTCAAGAACGAAATTTCGCACCTGCAGGCGCACATCAAGACGCTCCGCCTGGGCGCTGGGG
CCCTGGTCGTCGTCGCCCTGGTCATGGGCGCCGGCTGGTGGAGCGCCCCGCGCGACCTGACCATCCACGT
CCCGCCCGACCTGCGCTCCGGCAGTACCCGCAAATGGTGGGAGGTACCGCCCGAATCGGTCTATGCGTTC
ACGTTCTACGTGTTCCAGACGCTGAACCGCTGGCCGACGAATGGCGAAGAGGACTACGCACGCAACCTCC
ATACGCTCTCGCCGTACCTCACCCCGTCCTGCCAGGCCTTCCTGCGCGCGGACTATGACTACCGCCGCAG
CACGGGCGAGCTGCGCCAGCGCGTGCGCGGCATCTACGAAATCCCCGGCCGCGGCTACGGCGACGACCCC
ACGGCGCGCGTGCGCGTGGTCTCCGACCGCGACTGGGTGGTGACGCTCGACATCACCGCCGACGAGTACT
ACGGCGCCGAGCAGGTCAAGCGCGCTCTCGTGCGCTACCCGGTGAAAGTCACGCGGGTGGACGTCGATCC
CGCCCGCAACCCGTTCGGCCTGGCGCTGGACTGCTACGACGGTGCGCCCCAGCGCATCAGCGCCCCGGAG
CCGACGCGCCCGGCGCCTGGCGGCCTGTCTCCGCAAGCGCCCCAAGGAGAAAACACCCCATGA
 Primer design