SecReT4
Protein ID: 78047928
T4SS name [ID]Tfc [684]
Gene symbol-
Locus tagXCV2372
StrainXanthomonas campestris pv. vesicatoria str. 85-10
Repliconchromosome [GenBank: NC_007508] [Browse all T4SS(s) in this replicon]
Location [Strand]2701966..2702364 [-]
Producthypothetical protein
Component typeTfc11
UniProt IDQ3BT10
KEGG IDxcv:XCV2372
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 6.7e-49, Aligned region: 10..130
Protein Sequence: 132 a.a.     [Download]
>gi|78047928|ref|YP_364103.1| hypothetical protein XCV2372 [Xanthomonas campestris pv. vesicatoria str. 85-10]
MSEQQHVRADGTVTFLPHRLNRHPVVVRGLTADELWICCGLSGAAGLLVGAPLSWVFRTIAIAPTFVVLG
VALGIFVGGGILRRLKRGRPDTWLYRQLQWRIATRHPLMAGWVGGHALISRSGFWTTRRSTQ
 
Nucleotide Sequence: 399 bp     [Download]
>gi|78045556|ref|NC_007508.1|:c2702364-2701966 Xanthomonas campestris pv. vesicatoria str. 85-10 chromosome, complete genome
ATGTCCGAGCAGCAGCACGTCCGTGCGGACGGGACGGTCACGTTCCTTCCGCACCGGCTCAACCGTCATC
CCGTTGTCGTGCGCGGCCTCACCGCCGACGAGCTGTGGATCTGCTGCGGCCTGTCCGGTGCCGCCGGCCT
GCTGGTCGGTGCCCCGTTGTCCTGGGTGTTCCGCACCATCGCCATCGCGCCGACGTTCGTTGTCCTGGGT
GTGGCCCTGGGCATCTTCGTCGGCGGCGGCATCCTGCGCCGGCTCAAGCGCGGACGTCCCGACACCTGGC
TGTATCGGCAACTGCAATGGCGAATCGCCACTCGCCATCCACTGATGGCCGGCTGGGTGGGCGGCCATGC
GCTGATCTCGCGCTCGGGCTTCTGGACCACACGCAGGAGCACGCAATGA
 Primer design