SecReT4
Protein ID: 78047931
T4SS name [ID]Tfc [684]
Gene symbol-
Locus tagXCV2375
StrainXanthomonas campestris pv. vesicatoria str. 85-10
Repliconchromosome [GenBank: NC_007508] [Browse all T4SS(s) in this replicon]
Location [Strand]2702981..2703361 [-]
Producthypothetical protein
Component typeTfc9
UniProt IDQ3BT07
KEGG IDxcv:XCV2375
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 3.3e-30, Aligned region: 28..108
Protein Sequence: 126 a.a.     [Download]
>gi|78047931|ref|YP_364106.1| hypothetical protein XCV2375 [Xanthomonas campestris pv. vesicatoria str. 85-10]
MLAPIWQRAAHRGVPIFLVTALLGQSPMALAESPAQRQELVAALRQLGALERSVADSAAHAPVQPGERYH
FDYPRLLADLARVRAGIQAHLAPSRAQPRDPSELAGDYRAERAASPSPTATAEGKP
 
Nucleotide Sequence: 381 bp     [Download]
>gi|78045556|ref|NC_007508.1|:c2703361-2702981 Xanthomonas campestris pv. vesicatoria str. 85-10 chromosome, complete genome
ATGTTGGCTCCGATCTGGCAGCGTGCCGCGCATCGCGGCGTGCCCATCTTTCTCGTGACGGCCCTGCTGG
GTCAGTCCCCGATGGCGTTGGCCGAATCCCCCGCACAGCGCCAGGAGCTGGTCGCCGCGCTGCGCCAGCT
CGGCGCGCTGGAGCGCTCCGTCGCCGACAGCGCCGCGCATGCCCCCGTCCAGCCGGGCGAGCGCTACCAC
TTCGACTACCCGCGGCTGCTGGCTGACCTGGCGCGCGTGCGCGCCGGCATCCAGGCCCATCTCGCACCGT
CGCGTGCCCAGCCGCGCGATCCCTCCGAACTGGCCGGCGACTACCGCGCCGAGCGGGCCGCTTCGCCATC
GCCGACGGCGACTGCGGAAGGCAAGCCATGA
 Primer design