SecReT4
Protein ID: 78047932
T4SS name [ID]Tfc [684]
Gene symbol-
Locus tagXCV2376
StrainXanthomonas campestris pv. vesicatoria str. 85-10
Repliconchromosome [GenBank: NC_007508] [Browse all T4SS(s) in this replicon]
Location [Strand]2703460..2704209 [-]
Producthypothetical protein
Component typeTfc8
UniProt IDQ3BT06
KEGG IDxcv:XCV2376
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 2.7e-70, Aligned region: 46..246
Protein Sequence: 249 a.a.     [Download]
>gi|78047932|ref|YP_364107.1| hypothetical protein XCV2376 [Xanthomonas campestris pv. vesicatoria str. 85-10]
MKDAASTAQREQNQRQGLIVGTITLPFRLLGVLIGSLLFSIVVECVGMHLFWKDQGWRHSQEMLQYELGH
LSSHFTRSVVVQEPGRTAHELVDTGYEWVFVRSGLLERMSQTAGRARAPSQGQTHNFRYYISQVYVWTES
YLIAAAFTTLTFLVRLLILVLTLPLIFTAAFVGLIDGLVRRDVRRFGAGRESGFIYHRAKASLMPLAVLP
WVTYLALPISVHPLLILLPSAALLGLAVSLTAGSFKKYL
 
Nucleotide Sequence: 750 bp     [Download]
>gi|78045556|ref|NC_007508.1|:c2704209-2703460 Xanthomonas campestris pv. vesicatoria str. 85-10 chromosome, complete genome
ATGAAGGACGCCGCCTCGACTGCGCAGAGGGAGCAGAACCAGCGCCAGGGCCTGATCGTCGGCACCATCA
CCTTGCCGTTCCGGCTGCTCGGGGTACTGATCGGCTCGCTGCTGTTCTCGATCGTCGTGGAGTGCGTCGG
CATGCACCTGTTCTGGAAGGACCAGGGCTGGCGGCACTCGCAGGAGATGTTGCAGTACGAACTGGGGCAC
CTGTCCAGCCACTTCACGCGCAGCGTGGTCGTGCAGGAGCCGGGGCGCACGGCGCACGAGCTGGTGGACA
CCGGCTACGAATGGGTATTCGTGCGCTCCGGTCTGCTGGAACGCATGAGCCAGACCGCCGGACGCGCCCG
CGCTCCCAGCCAGGGACAGACGCACAATTTCCGCTACTACATCAGCCAGGTTTATGTCTGGACCGAGAGC
TACCTGATCGCCGCTGCTTTCACGACGCTCACGTTCCTGGTGCGCCTTCTGATCCTGGTGCTCACGCTGC
CGCTGATCTTCACCGCCGCGTTCGTTGGCCTGATCGACGGCCTGGTGCGCCGGGACGTGCGCCGGTTCGG
CGCAGGCCGGGAATCCGGCTTCATCTACCACCGCGCGAAGGCGAGCCTGATGCCGCTGGCCGTGCTGCCG
TGGGTCACGTACCTCGCGCTGCCGATCTCGGTGCATCCGCTGCTGATCCTGCTGCCGAGCGCCGCCTTGC
TGGGGCTGGCGGTCTCCCTGACCGCGGGGAGCTTCAAGAAGTACCTCTAG
 Primer design