SecReT4
Protein ID: 78047934
T4SS name [ID]Tfc [684]
Gene symbol-
Locus tagXCV2378
StrainXanthomonas campestris pv. vesicatoria str. 85-10
Repliconchromosome [GenBank: NC_007508] [Browse all T4SS(s) in this replicon]
Location [Strand]2706403..2706942 [-]
Producthypothetical protein
Component typeTfc5
UniProt IDQ3BT04
KEGG IDxcv:XCV2378
PDB IDNA
Domain hit(s) vs Pfam DUF2859 [PF11072], Evalue: 4.3e-52, Aligned region: 31..178
Protein Sequence: 179 a.a.     [Download]
>gi|78047934|ref|YP_364109.1| hypothetical protein XCV2378 [Xanthomonas campestris pv. vesicatoria str. 85-10]
MTTSHLAFRGLLVLLAGLPLASRAGEPLIVVEDRGGAAALPYYEALNLQPRAGAPARPPIPMPQVPSTPA
DEAAMLPVRSAKLTPGTVAQRVIEAPGLRPFVVVGDDETSRAWLRRRAVALRERGAVGLVVNIETVQALA
RLRALVPGVPLAPVSGDDLAERLGLQHYPALITATGIEQ
 
Nucleotide Sequence: 540 bp     [Download]
>gi|78045556|ref|NC_007508.1|:c2706942-2706403 Xanthomonas campestris pv. vesicatoria str. 85-10 chromosome, complete genome
ATGACGACATCCCATCTGGCCTTTCGGGGTCTGCTCGTACTGCTGGCGGGCCTGCCGCTGGCCTCGCGTG
CCGGCGAGCCGCTGATCGTGGTCGAAGACCGGGGCGGCGCGGCGGCGCTGCCGTACTACGAAGCCCTGAA
CCTCCAGCCGCGCGCCGGAGCGCCGGCCCGGCCGCCGATCCCGATGCCCCAGGTTCCCTCCACGCCGGCA
GACGAGGCCGCGATGCTGCCGGTACGCAGCGCCAAGCTCACACCCGGCACCGTCGCGCAGCGGGTCATCG
AGGCTCCGGGTCTGCGGCCTTTCGTGGTCGTCGGCGACGACGAAACTTCCCGGGCCTGGCTGCGTCGCCG
TGCGGTTGCGCTGCGCGAGCGCGGCGCGGTCGGCCTGGTGGTCAACATCGAGACCGTGCAGGCCTTGGCG
CGGTTGCGCGCCCTGGTGCCCGGCGTGCCGCTCGCACCCGTGTCCGGCGACGACCTGGCCGAGCGCCTGG
GCCTGCAGCACTACCCGGCGCTGATCACGGCCACCGGCATCGAGCAATGA
 Primer design