SecReT4
Protein ID: 78047935
T4SS name [ID]Tfc [684]
Gene symbol-
Locus tagXCV2379
StrainXanthomonas campestris pv. vesicatoria str. 85-10
Repliconchromosome [GenBank: NC_007508] [Browse all T4SS(s) in this replicon]
Location [Strand]2706939..2707529 [-]
Productlytic transglycosylase precursor
Component typeTfc4
UniProt IDQ3BT03
KEGG IDxcv:XCV2379
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 196 a.a.     [Download]
>gi|78047935|ref|YP_364110.1| lytic transglycosylase precursor [Xanthomonas campestris pv. vesicatoria str. 85-10]
MAAPAVAVPLRALMLVAGLCACVAQAQEVPPPAYQLAAQRAGIPSTVLYAVALQESGIRRNGRTVPWPWS
LNVAGQSRRFATRADACAGLQQAMRSTPHTRIDAGLGQINLGYHQRRYANACDLLDPYRNLATAAEILKE
QHAPGEDWLLAIGRYHRPAGGEPAARYRRSVSRHLARVQGARPAAAALAARQETSP
 
Nucleotide Sequence: 591 bp     [Download]
>gi|78045556|ref|NC_007508.1|:c2707529-2706939 Xanthomonas campestris pv. vesicatoria str. 85-10 chromosome, complete genome
ATGGCAGCGCCAGCCGTAGCCGTCCCCCTGCGCGCACTGATGCTCGTCGCTGGCTTGTGCGCCTGCGTAG
CCCAGGCCCAGGAGGTTCCGCCACCGGCCTACCAGCTTGCCGCCCAGCGAGCAGGCATCCCTTCGACGGT
GCTCTACGCCGTGGCCTTGCAGGAGAGCGGCATCCGCCGCAACGGTCGCACCGTCCCGTGGCCGTGGTCC
CTCAACGTCGCCGGCCAGTCGCGCCGCTTTGCCACGCGCGCCGATGCCTGCGCAGGTCTCCAGCAGGCGA
TGCGCTCCACGCCGCACACGCGCATCGACGCGGGCCTGGGCCAGATCAACCTCGGCTATCACCAGCGGCG
CTACGCCAATGCGTGCGACTTGCTCGACCCGTACCGCAACCTCGCCACCGCTGCCGAGATCCTGAAGGAA
CAGCACGCCCCCGGCGAGGACTGGTTGCTGGCGATCGGCCGCTACCACCGCCCCGCGGGCGGTGAACCCG
CTGCCCGCTATCGCCGTAGCGTGTCCCGCCACCTTGCCCGTGTGCAGGGCGCGCGCCCAGCCGCCGCGGC
CCTCGCCGCGCGCCAGGAGACATCCCCATGA
 Primer design