SecReT4
Protein ID: 78047936
T4SS name [ID]Tfc [684]
Gene symbol-
Locus tagXCV2380
StrainXanthomonas campestris pv. vesicatoria str. 85-10
Repliconchromosome [GenBank: NC_007508] [Browse all T4SS(s) in this replicon]
Location [Strand]2707511..2708236 [-]
Producthypothetical protein
Component typeTfc3
UniProt IDQ3BT02
KEGG IDxcv:XCV2380
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 241 a.a.     [Download]
>gi|78047936|ref|YP_364111.1| hypothetical protein XCV2380 [Xanthomonas campestris pv. vesicatoria str. 85-10]
MKPSIILSAFLLASAQWPAWAQQPTSAPARNAQSQERPLATRALDDRVASDWGLQPQEWARYRELMDGPL
GIYSPNLDPLSALGIEARTDEERRRYAELQVQVEARRVEKLLAYQRAYDEAWQRLNPGMQRVNLPDDKPA
AGATRGSGRTAVFVKDGCAACDQLVQRLQSAGTEFDLYMVGSRQDDGRIRDWAKRANVDPARVRGGTITL
NHDGGRWLSLGLPGDLPAVVREVNGQWQRQP
 
Nucleotide Sequence: 726 bp     [Download]
>gi|78045556|ref|NC_007508.1|:c2708236-2707511 Xanthomonas campestris pv. vesicatoria str. 85-10 chromosome, complete genome
ATGAAGCCGTCGATCATCCTCTCCGCGTTCCTGCTGGCCTCGGCCCAGTGGCCCGCCTGGGCCCAGCAGC
CCACCTCCGCTCCCGCCCGCAATGCGCAGAGCCAGGAGCGCCCGCTGGCCACCCGCGCCCTGGACGACCG
GGTGGCAAGCGACTGGGGGCTGCAACCACAGGAATGGGCGCGCTACCGCGAACTGATGGACGGGCCCTTG
GGCATCTACTCGCCCAATCTGGACCCGCTGTCGGCCCTGGGCATCGAGGCCCGCACCGATGAAGAACGGC
GGCGCTATGCCGAACTGCAAGTGCAAGTCGAAGCGCGCCGCGTGGAGAAGCTGCTCGCCTATCAGCGTGC
CTACGACGAGGCCTGGCAGCGCTTGAACCCCGGCATGCAACGGGTAAACCTGCCTGACGACAAGCCAGCG
GCCGGAGCCACGCGCGGCTCGGGTCGCACGGCGGTGTTCGTGAAGGACGGTTGCGCGGCCTGCGACCAGC
TCGTGCAGCGTCTGCAATCGGCGGGCACCGAGTTCGACCTGTACATGGTGGGTAGCCGCCAGGACGACGG
GCGCATCCGCGATTGGGCCAAGCGCGCGAACGTCGATCCTGCGCGCGTGCGCGGCGGCACCATCACGCTG
AACCATGACGGCGGCCGCTGGCTGTCGCTGGGCCTGCCCGGCGACTTGCCCGCGGTCGTGCGCGAGGTGA
ACGGCCAATGGCAGCGCCAGCCGTAG
 Primer design