SecReT4
Protein ID: 78047938
T4SS name [ID]Tfc [684]
Gene symbol-
Locus tagXCV2382
StrainXanthomonas campestris pv. vesicatoria str. 85-10
Repliconchromosome [GenBank: NC_007508] [Browse all T4SS(s) in this replicon]
Location [Strand]2708872..2709471 [-]
Producthypothetical protein
Component typeTfc2
UniProt IDQ3BT00
KEGG IDxcv:XCV2382
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 199 a.a.     [Download]
>gi|78047938|ref|YP_364113.1| hypothetical protein XCV2382 [Xanthomonas campestris pv. vesicatoria str. 85-10]
MCPSPPWFHHPERRLLAGFLGLLWSVLAGGCATASAPVAPDTIEEVSAAPVPEAPEYIPVVRYDRYTLVE
LAPTAAQRDLLLQTIDVSMPEDARATVGDGLRHVLKRSGYGLCRTAHAVIELYTLPLPAAHLHLGPMTLR
DALLTLAGPAWELHADDRARQICFERPGDSMTADNVPAPPATEAVQTFPLVPEASEGQP
 
Nucleotide Sequence: 600 bp     [Download]
>gi|78045556|ref|NC_007508.1|:c2709471-2708872 Xanthomonas campestris pv. vesicatoria str. 85-10 chromosome, complete genome
ATGTGCCCCTCTCCCCCCTGGTTTCACCATCCCGAACGCCGCCTGCTGGCGGGTTTTCTCGGCCTGCTTT
GGTCGGTGCTGGCTGGCGGCTGCGCGACGGCGAGCGCGCCGGTCGCGCCCGACACCATCGAGGAAGTCTC
GGCCGCGCCCGTACCCGAGGCGCCCGAGTACATCCCCGTCGTGCGCTACGACCGCTACACCCTCGTGGAA
CTGGCACCAACAGCAGCGCAGCGCGACCTGCTGTTGCAGACCATCGACGTGTCGATGCCCGAGGATGCAC
GCGCCACGGTCGGCGACGGGCTACGGCATGTGCTCAAGCGCAGCGGTTACGGCTTGTGCCGGACGGCGCA
CGCGGTGATCGAGCTGTACACCCTGCCGCTGCCGGCGGCGCACCTGCACCTCGGCCCCATGACCCTGCGC
GATGCGCTGCTCACCCTGGCTGGTCCGGCCTGGGAACTGCACGCGGATGACCGCGCGCGGCAAATCTGCT
TCGAGCGGCCCGGCGACAGCATGACCGCCGACAACGTACCCGCGCCGCCCGCCACCGAGGCGGTGCAGAC
GTTCCCGCTGGTGCCCGAGGCATCGGAAGGTCAGCCATAA
 Primer design