SecReT4
Protein ID: 83269012
T4SS name [ID]VirB [376]
Gene symbol-
Locus tagBAB2_0058
StrainBrucella melitensis biovar Abortus 2308
Repliconchromosome II [GenBank: NC_007624] [Browse all T4SS(s) in this replicon]
Location [Strand]56647..57735 [-]
Producttype II secretion system protein E
Component typeVirB11
UniProt IDQ2YJ82
KEGG IDbmf:BAB2_0058
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 3.4e-66, Aligned region: 26..328
Protein Sequence: 362 a.a.     [Download]
>gi|83269012|ref|YP_418303.1| type II secretion system protein E [Brucella melitensis biovar Abortus 2308]
MMSNRSDFIVPDEAAVKRAASVNFHLEPLRPWLDDPQITEVCVNRPGEVFCERASAWEYYAVPNLDYEHL
ISLGTATARFVDQDISDSRPVLSAILPMGERIQIVRPPACEHGTISVTIRKPSFTRRTLEDYAQQGFFKH
VRPMSKSLTPFEQELLALKEAGDYMSFLRRAVQLERVIVVAGETGSGKTTLMKALMQEIPFDQRLITIED
VPELFLPDHPNHVHLFYPSEAKEEENAPVTAATLLRSCLRMKPTRILLAELRGGETYDFINVAASGHGGS
ITSCHAGSCELTFERLALMVLQNRQGRQLPYEIIRRLLYLVVDVVVHVHNGVHDGTGRHISEVWYDPNTK
RALSLQHSEKTQ
 
Nucleotide Sequence: 1089 bp     [Download]
>gi|83268957|ref|NC_007624.1|:c57735-56647 Brucella melitensis biovar Abortus 2308 chromosome II, complete sequence
ATGATGTCAAACCGAAGTGACTTTATTGTGCCTGACGAGGCGGCTGTCAAACGGGCGGCCTCGGTCAATT
TCCATCTGGAACCGCTACGCCCTTGGTTGGACGATCCGCAGATCACCGAAGTTTGCGTGAACCGGCCGGG
CGAAGTGTTCTGCGAGCGAGCAAGCGCGTGGGAATACTATGCGGTGCCAAACCTCGACTATGAACACCTG
ATTTCGCTGGGAACCGCCACCGCGCGGTTTGTGGATCAGGATATTTCGGACAGCCGACCGGTGCTGTCTG
CGATCCTGCCGATGGGTGAGCGCATTCAGATTGTGCGCCCGCCCGCATGTGAGCACGGCACCATCTCGGT
GACGATCCGCAAGCCGTCTTTCACCCGGCGCACACTGGAAGACTATGCGCAGCAGGGCTTTTTCAAACAC
GTCAGACCCATGAGTAAGAGCCTGACGCCGTTTGAACAGGAACTGCTCGCATTGAAGGAAGCTGGTGATT
ACATGAGCTTCCTGCGGCGGGCGGTACAGCTTGAAAGGGTGATCGTCGTCGCCGGCGAGACGGGATCAGG
CAAGACCACACTGATGAAAGCGCTGATGCAGGAAATTCCGTTCGATCAGCGCCTGATCACCATCGAGGAC
GTACCGGAGTTGTTCTTGCCGGACCATCCGAACCACGTCCACCTGTTTTATCCGAGCGAAGCGAAGGAAG
AAGAAAACGCACCAGTGACGGCCGCCACGCTACTGCGGAGCTGCCTGCGCATGAAACCGACGCGCATCCT
GCTTGCCGAGCTGCGCGGCGGCGAGACTTACGATTTCATCAACGTGGCCGCGTCCGGCCATGGCGGCAGC
ATCACCAGTTGCCATGCCGGTTCGTGCGAACTGACTTTCGAGCGGCTGGCATTGATGGTGTTGCAGAACC
GCCAGGGCCGCCAGTTGCCATACGAGATCATCCGCCGGCTGCTCTATCTGGTGGTGGATGTCGTCGTGCA
CGTCCACAATGGCGTGCACGACGGCACTGGCCGCCATATATCTGAAGTTTGGTACGACCCGAATACAAAA
CGGGCACTGTCACTGCAACACAGTGAGAAGACGCAATGA
 Primer design