SecReT4
Protein ID: 83269016
T4SS name [ID]VirB [376]
Gene symbol-
Locus tagBAB2_0062
StrainBrucella melitensis biovar Abortus 2308
Repliconchromosome II [GenBank: NC_007624] [Browse all T4SS(s) in this replicon]
Location [Strand]60467..60640 [-]
Producttype IV secretion system protein VirB7
Component typeVirB7
UniProt IDQ2YJ77
KEGG IDbmf:BAB2_0062
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 57 a.a.     [Download]
>gi|83269016|ref|YP_418307.1| type IV secretion system protein VirB7 [Brucella melitensis biovar Abortus 2308]
MKKVILAFVATAFLAGCTTTGPAVVPVLDGKPRVPVNKSVPAKPPLAQPNPVDTYED
 
Nucleotide Sequence: 174 bp     [Download]
>gi|83268957|ref|NC_007624.1|:c60640-60467 Brucella melitensis biovar Abortus 2308 chromosome II, complete sequence
ATGAAAAAGGTAATCCTTGCTTTTGTCGCCACGGCCTTCCTTGCCGGTTGCACTACAACGGGGCCGGCCG
TGGTGCCGGTTCTCGATGGCAAACCGCGGGTTCCCGTCAACAAAAGCGTTCCGGCTAAACCGCCCCTGGC
TCAGCCTAACCCCGTTGACACTTACGAGGACTAA
 Primer design